RetrogeneDB ID:
retro_mputfur_1021
Organism:
Location:
GL896995.1:7442433-7442834 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
58.27 %
Coverage:
91.22 %
Frameshifts:
4
Stop codons:
3


Parental gene:
Parental gene symbol:
CRLS1
Parental gene aliases:
No gene alias available
Parental gene description:
cardiolipin synthase 1 [Source:HGNC Symbol;Acc:16148]

Genomic region (view in browser)





>retro_mputfur_1021
ATCAACTTGGCTCTAGTTTGGGGCCATTTGGTTACTAGAGAACTTTTGGATATTGCACTA
AGAGTTTTCATTCTAGTGGGCTCACTAATTTGCTGGGTGGATTTATTGCTTGAAATTGGG
ACAATTATTAATCACCTTGGGAAAATGTTCTTGGTCCTCTTGCTGGTGAAATCCCTATCA
ACATCCTATATATTAGTTTGACCTCTGCATATCTTACTCCAGTTTCACTTATTTATATGA
TAATTTCAAAGATGTAATATTGGTTGCTACCATTTTTATGTCAGATATTGCATTCTTCCA
ACTCTGAGAACACTTTCTAAGTATTTCAATCCTTGCTGTGTCACTGCTAAATGAAAACGA
ACATGCATCATTAAAGTAAACACAGCAGTCCAGTTAATCTT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
IGLAPVLGYLIIEEDFNIALGVFAL-AGLTDLLDGFIARNWANQKSALGSALDPLADKILISILYISLTYADLIPVPLTYMIIS-RDVMLIAAV-FYVRY
I.LA.V.G.L...E...IAL.VF.L..GLT.LL.GFIA.NW.N..S.....L.PLA..I.I.ILYISLT.A.L.PV.L.YMIIS..DV.L.A...FYVRY
Retrocopy
INLALVWGHLVTRELLDIALRVFIL/SGLTNLLGGFIA*NWDNY*SPWENVLGPLAGEIPINILYISLTSAYLTPVSLIYMIIS/KDVILVATI/FYVRY


Parental protein
RTLPTPRTLSKYFNPCYATARLKPTFISKV-RHTHPFKL
..LPT.RTLSKYFNPC..TA..K.T.I.KV..H..P..L
Retrocopy
CILPTLRTLSKYFNPCCVTAK*KRTCIIKV/KHSSPVNL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide