RetrogeneDB ID:
retro_mputfur_1022
Organism:
Location:
GL896996.1:1240145-1240452 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
50.48 %
Coverage:
79.23 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
RPS15A
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S15a [Source:HGNC Symbol;Acc:10389]

Genomic region (view in browser)





>retro_mputfur_1022
AGGCCGGGCTCCAAAGCCATCACTGGTCCCTGGCTGTGGCGATGACCCATGGTCACCCCG
GCGAGTCTGAGGTCACCGAGGATTACAGAGCCGGGAACACTGCTGCCACCCTCCCGGGCA
GGTTAAACTCGTGTGGAGAGATGGGCCCCAGACGTCATGTACAACTCCGAGATCTAGAAA
AGACGGCGGAGTCACCCGCTCGCGTCCCGGTGTGGATCCTCATCATTCTGACCACCTCGG
CTGGGACGATTACCCATGAAGAAGCCAGATGAAAATGCACAGGAGGGGAAGTCCCGGATT
CTTTTTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RPCSKVIVR-FLTVMMKHGYIGEFEIIDDHRAGKIVVNLTGRLNKCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKHTGGKI-
RP.SK.I....L.V.M.HG..GE.E...D.RAG.....L.GRLN.CG...PR..VQL.DLEK.............I.LTTSAG...HEEAR.K.TGG...
Retrocopy
RPGSKAITG/SLAVAMTHGHPGESEVTEDYRAGNTAATLPGRLNSCGEMGPRRHVQLRDLEKTAESPARVPVWILIILTTSAGTITHEEAR*KCTGGEV/


Parental protein
LGFFF
.GFFF
Retrocopy
PGFFF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide