RetrogeneDB ID:
retro_mputfur_1023
Organism:
Location:
GL896997.1:438000-438364 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
76.61 %
Coverage:
85.82 %
Frameshifts:
3
Stop codons:
0


Parental gene:
Parental gene symbol:
POMP
Parental gene aliases:
No gene alias available
Parental gene description:
proteasome maturation protein [Source:HGNC Symbol;Acc:20330]

Genomic region (view in browser)





>retro_mputfur_1023
GCCAGCAGACGTTTTGAAAGTCATGATCATCTTCCAAAAGGCTTTCCTTGTGTGAAAAAT
GAACATTTGGATTATCAGAACTCTTGAAGTATCAGAAAAAAATTTTCAGTTCAACCAAGA
TAAAATGAATTTTTCTACACTCAGAAACATCCAGGGTCTGTCTGCTCCACTCACATTACA
AACGGAATTCAAGGCAGCGCAGCTGGTTCAGCGTCTTCCATTGCTTCCGAGCTCCGAACC
TTTCACTGGGTATTTTGAGGATAATGAGGAGACTACTGGGTTTGAAGATATTCTTAATGC
CCCATCACAAAGTGAACGAATGGGACAGCCACACTTGATGGTGGAATATAAACTCAGTTT
ACTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ASGPFESHDLLRKGLPCVKNELLPSH-PLELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLPSS-NLSLDILR-GNDETIGFEDI
AS..FESHD.L.KG.PCVKNE.L.....LE.SEKNFQ.NQDKMNFSTLRNIQGL.APL.LQ.EFKA.Q.VQRLP.LPSS.NLSL.ILR..N.ET.GFEDI
Retrocopy
ASRRFESHDHLPKGFPCVKNEHLDYQ\TLEVSEKNFQFNQDKMNFSTLRNIQGLSAPLTLQTEFKAAQLVQRLPLLPSS\NLSLGILR/DNEETTGFEDI


Parental protein
LNDPSQSELMGEPHLMVEYKLGLL
LN.PSQSE.MG.PHLMVEYKL.LL
Retrocopy
LNAPSQSERMGQPHLMVEYKLSLL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide