RetrogeneDB ID:
retro_mputfur_1024
Organism:
Location:
GL896997.1:1597269-1597560 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
61.0 %
Coverage:
50.79 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
NME4
Parental gene aliases:
No gene alias available
Parental gene description:
NME/NM23 nucleoside diphosphate kinase 4 [Source:HGNC Symbol;Acc:7852]

Genomic region (view in browser)





>retro_mputfur_1024
CTGCAGAGGAAGCCCTTCTGTGCAGCCCTTATCAGCTCCATGAGCTCCTGGCCCCATGGC
TGCAGTGGTCTGGGAGGTCCCCACGTGGTCTGCTCTAGGGCCATGATGGGACCCACTGCT
TCCGCTGAGACTGCCCCCAGCACCAGCAGGGGGGACATCAGCAGCCATGTCAGCAAGAAG
GGCAACCACGCCAGCGACTCCATGAGAGGACCCCGGGGTGGGGTGCTCCAGCTGGGATCA
CAGAGCCACGAGCTGATGGACTGGGCAGACGAAGGCCACTAGAGCAACATC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LQRKPFYPALISYMTS-GPVVAMVWE-GPNVVGSSRAMIGHTDSAEAAPGTIRGDFSIHISRNIIHASDSVEGAQREI-QLWFQSSELVDWADEGHQSGI
LQRKPF..ALIS.M.S.GP..A.VWE.GP.VV..SRAM.G.T.SAE.AP.T.RGD.S.H.S....HASDS..G......QL..QS.EL.DWADEGH.S.I
Retrocopy
LQRKPFCAALISSMSS\GPMAAVVWE/GPHVV-CSRAMMGPTASAETAPSTSRGDISSHVSKKGNHASDSMRGPRGGVLQLGSQSHELMDWADEGH*SNI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide