RetrogeneDB ID:
retro_mputfur_1029
Organism:
Location:
GL896997.1:5635749-5636147 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
59.56 %
Coverage:
62.44 %
Frameshifts:
3
Stop codons:
3


Parental gene:
Parental gene symbol:
2610318N02Rik
Parental gene aliases:
No gene alias available
Parental gene description:
RIKEN cDNA 2610318N02 gene [Source:MGI Symbol;Acc:MGI:1917708]

Genomic region (view in browser)





>retro_mputfur_1029
CATCTACTGCAACACACCCTTGGCCTCTTCCCTCTGCTGCCTGACAGGTCTGTGGTGAAG
TTATAAGTTGTAAGGTCTGAACTGAAATTAAACTGGGCTGGCCTGTCACTGAACCCAAAA
AGCCACATGGTTAATTTGACCGCCTTTGTCCTCAACTTTGGAGGCCTCATTTCTCAAACC
TGGTTGGAAATGGTGAGCACAAGCCCCATTGCCCTGGCTCCCTAGCTCCTGGGCCTGATA
GGATTTCCCCAAAATGGAGAAGTTGCCACCCCTTCCTCTGAAGGCTTCCATCTTCACCAC
CCCATGTCTTGCTCAAGTTCCAGACTGTGCAGAGACCCAAGGATGACTCTGAAAAAGACC
TTACCAGCACAGAGTCTATGCCCCAACAAAAGGGGCCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
YTMPRVFGPFPPLPSKSMEKLEVARSEVKLNWAGLSSNPKRHMVDLTPLVLNPGGF-HFSYLAGNSAHKLHCPG-FPWTSACSGSPKTEETPLSPVKASI
.......G.FP.LP..S..KL.V.RSE.KLNWAGLS.NPK.HMV.LT..VLN.GG..HFS.L.GN..HK.HCPG..P...A....PK.E..P..P.KASI
Retrocopy
HLLQHTLGLFPLLPDRSVVKL*VVRSELKLNWAGLSLNPKSHMVNLTAFVLNFGGL/HFSNLVGNGEHKPHCPG/LPSSWA**DFPKMEKLPPLPLKASI


Parental protein
FTPP-VLLKFQPVPRPKDDSENDPSSTESVPPKRGP
FT.P.VLLKFQ.V.RPKDDSE.D..STES.P...GP
Retrocopy
FTTP\VLLKFQTVQRPKDDSEKDLTSTESMPQQKGP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide