RetrogeneDB ID:
retro_mputfur_1030
Organism:
Location:
GL896998.1:6257694-6258961 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
81.46 %
Coverage:
99.76 %
Frameshifts:
3
Stop codons:
1


Parental gene:
Parental gene symbol:
EEF1A2
Parental gene aliases:
No gene alias available
Parental gene description:
eukaryotic translation elongation factor 1 alpha 2 [Source:HGNC Symbol;Acc:3192]

Genomic region (view in browser)





>retro_mputfur_1030
ATGGGGAAGGAAAAGGCTCTATCTACATTGTTGTCATTGGACACGTAGATTCAGGCAAGT
CTACCACTACTGGTCATCTGATCTACAAATGTGGTGGGATCGACAAAAGAACTATCAAAA
AATTTGAGAAGGAGGCTACTGAGATGGGAAAAGTCTCCTTCAAGTATGCATGGGTCTTGG
ATAAACTGAAAGCTGAACATGAACGTGATATCACCATTGATATCTCCCTGTGGAAATTCG
AGACCAGCAAGTATTATGTGACTATCACATACTCCAGGACACAGAGACTTTATCAAAAAC
ATGATTACAGGCACATCTCAGGCTGACTGTGCTGTCCTGATTGTTGCTGCTGGTGTTGGT
GAATTTGAAGCCAGTATCTCCAAGAATGGGCAGACCCGTGAGCATGCCTTTCTGGCTTAC
ACACTGGGTGTAAAACAACTAATTGTTGGTGTTAACAAAATGGATTCCACTGAGCCACCC
TACAGCCAGAAGAGATATGAGGAAATCTTTAAGGAAGTCAGCATCTACATTAAGAAAATT
GGCTACAACCCCAACACAGTAGCATTTGTGCCAATTTCTGGTTGGAATGGTGACAACATG
CTGGAGCCAAGTGCTTACATGCCTTGGTTCAAGGGATGGAAAGTCATCCATAAAGATGGG
AATGCCAGTGGAACCACACTGCTTGAAGCTCTGGATTGCAACTTGCCACTAGCTCGTCCA
ACTGACAAGCCCTTGCGTCTGCCTCTCCAGGACATCTACATTATTGGTGTTATTGGTTCT
GCCCCTGTGAGCCGAGTGGAGACTGGTGTTCTTAAACCTGGCATGGTGGTCACCTTTTCT
CCAGTCAACGTTACAACTGAAGTCAAGTCTGTTGAAATGCACCATGAAGCTTTGAGTGAG
GCTCTTCCTGGGGACAGTGTGGGCTTCAATGTCAAGAACGTATCTGTCAAAGATGTTTGT
CGTGGCAATGTGACTGGTTACAGCAAAAATGACCCACCAATGGAAGCAGTTGTCTTTATA
GCTCAGGTGATTATCCTGAACCATCCAGGCCAAATTAATGCTGGATATGCACCTGTGCTG
GATTGTCACACAGCTGCTCACATTGCTTGCTTGCAAGTTTGCTGAGCTGAAGGAGAAGAT
AGATCGTCATTCTGGAAAAAAGTTGGAAGATGGTCCCAAGTTCTTGAACTCTGGTGACGC
TGCCATTGTTGATATGGTTCCTGGCAAGCCTATGTGTGTTGAGAGCTTCTCTGACTATCC
TCCTCTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MGKEKT-HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYITIID-APGHRDF
MGKEK...I.IVVIGHVDSGKSTTTGHLIYKCGGIDKRTI.KFEKEA.EMGK.SFKYAWVLDKLKAE.ER.ITIDISLWKFET.K.Y...I...PGHRDF
Retrocopy
MGKEKA/SIYIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIKKFEKEATEMGKVSFKYAWVLDKLKAEHERDITIDISLWKFETSK-YYVTIT\TPGHRDF


Parental protein
IKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHG
IKNMITGTSQADCAVLIVAAGVGEFEA.ISKNGQTREHA.LAYTLGVKQLIVGVNKMDSTEP.YS.KRY.EI.KEVS.YIKKIGYNP.TV.FVPISGW.G
Retrocopy
IKNMITGTSQADCAVLIVAAGVGEFEASISKNGQTREHAFLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIFKEVSIYIKKIGYNPNTVAFVPISGWNG


Parental protein
DNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLRPGMVVTFAPVNITTEVKSVEMHHEA
DNMLEPS..MPWFKGWKV..K.GNASG..LLEALD..LP..RPTDKPLRLPLQD.Y.IG.IG..PV.RVETGVL.PGMVVTF.PVN.TTEVKSVEMHHEA
Retrocopy
DNMLEPSAYMPWFKGWKVIHKDGNASGTTLLEALDCNLPLARPTDKPLRLPLQDIYIIGVIGSAPVSRVETGVLKPGMVVTFSPVNVTTEVKSVEMHHEA


Parental protein
LSEALPGDNVGFNVKNVSVKDIRRGNVCGDSKSDPPQEAAQFTSQVIILNHPGQISAGYSPVIDCHT-AHIACKFAELKEKIDRRS-GKK-LEDNPKALK
LSEALPGD.VGFNVKNVSVKD..RGNV.G.SK.DPP.EA..F..QVIILNHPGQI.AGY.PV.DCHT.AHIAC......E..DR.S..KK.LED.PK.L.
Retrocopy
LSEALPGDSVGFNVKNVSVKDVCRGNVTGYSKNDPPMEAVVFIAQVIILNHPGQINAGYAPVLDCHTAAHIACLQVC*AEGEDRSSFWKK\LEDGPKFLN


Parental protein
SGDAAIVEMVPGKPMCVESFSQYPPL
SGDAAIV.MVPGKPMCVESFS.YPPL
Retrocopy
SGDAAIVDMVPGKPMCVESFSDYPPL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide