RetrogeneDB ID:
retro_mputfur_1037
Organism:
Location:
GL896999.1:83306-84187 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
87.12 %
Coverage:
77.98 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
SERPINB6
Parental gene aliases:
No gene alias available
Parental gene description:
serpin peptidase inhibitor, clade B (ovalbumin), member 6 [Source:HGNC Symbol;Acc:8950]

Genomic region (view in browser)





>retro_mputfur_1037
AATGCACAGTACTTGTTTAGAACTGCCAACAGCCTCTTTGGAGACAAGTCTCATGAATTC
CTCTCGTCTTTCAAAAACTCCTGCCTCAAGTTCTACCAAGCTGAGATAGAAGAGCTCGAC
TTTCATACCGCTGCGGAAGAGACCAGGGCACACATCAACACCTGGGTGGCTGAAAAGACG
GAAGGACAGATTACAGAGTTGCTGTCTCTGGGTTCAGTGGATTCAATGACTAATCTGATT
CTGGTGAATGCCATCTATTTCAAAAGATACTGGGATAATCAGTTTAACAAAACACAGACC
ATGGAAAGACCATTTAAAGTCAGCAAGAATGAGGAGAAACCTGTGAAGATGATGTTTAAA
AAATCTACCTTTCAAATGGCCTATATAGAGGAAATATTCACCAAAATTCTGGTGCTCTCC
TTTGTGGGCAAAGAGCTGAACATGATCATCATGCTTCTAGATGAAAACCCGGATTTGAGG
ATGGTGGAGAAAGAACTCACTTATGAGAAATTTGCAGAGTGGATGAGGCCAGACATGCTG
GACGAAGAAGAGGTGGAAGTTTTCCTCCCTAGATTTAAATTGGAGGAGGATTACGACAAG
AAGAATGTCCTTTGCTCTCTGGGCATGACCGATGCCTTTGAGCAGGCCAAGGCAGACTTC
TCTGGGATGTCGTCCAGGAAAGACCCGTATCTGTCCAGGGTGGTGCACAAGGCCTTAATG
GAGGTGAACAAGGAAGGCACAGAGGCTGCGGCGGCCACAGAGGCCATCACGATGTTGCGG
TGTGCAAGAATCATGCCCCGGTTCTGCGCCGACCACCCTTCCTCTTCTTTATCCAACACA
GCAAGACCAACAGCATCCTGTTCTGTGGCCACTTCTCCTCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
DTQYLLRTANRLFGNKSHEFLSSFKDSCLKFYQAEMEELDFHTAAEESRTHINTWVAEKTEGQIIELLSPGSVDPMTNLILVNAIYFKGNWDNQFNKTQT
..QYL.RTAN.LFG.KSHEFLSSFK.SCLKFYQAE.EELDFHTAAEE.R.HINTWVAEKTEGQI.ELLS.GSVD.MTNLILVNAIYFK..WDNQFNKTQT
Retrocopy
NAQYLFRTANSLFGDKSHEFLSSFKNSCLKFYQAEIEELDFHTAAEETRAHINTWVAEKTEGQITELLSLGSVDSMTNLILVNAIYFKRYWDNQFNKTQT


Parental protein
MERPFKVSKNEEKPVQMMFKKSTFQMTYIGEIFTKILVLPYVGKELNMIIMLPDENMDLRTVEKELTYEKFAEWTRPDMLDEEEVEVFLPRFKLAEDYDM
MERPFKVSKNEEKPV.MMFKKSTFQM.YI.EIFTKILVL..VGKELNMIIML.DEN.DLR.VEKELTYEKFAEW.RPDMLDEEEVEVFLPRFKL.EDYD.
Retrocopy
MERPFKVSKNEEKPVKMMFKKSTFQMAYIEEIFTKILVLSFVGKELNMIIMLLDENPDLRMVEKELTYEKFAEWMRPDMLDEEEVEVFLPRFKLEEDYDK


Parental protein
KNVLCSLGITDAFEPAKADFSGMSSGKDLYLSRVVHKAFVEVNEEGTEAAAATAAIMLLRCARIVPRFCADH-PFLFFIQHSKTNSILFCGRFSS
KNVLCSLG.TDAFE.AKADFSGMSS.KD.YLSRVVHKA..EVN.EGTEAAAAT.AI..LRCARI.PRFCADH.PFLFFIQHSKTNSILFCG.FSS
Retrocopy
KNVLCSLGMTDAFEQAKADFSGMSSRKDPYLSRVVHKALMEVNKEGTEAAAATEAITMLRCARIMPRFCADH/PFLFFIQHSKTNSILFCGHFSS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide