RetrogeneDB ID:
retro_mputfur_1038
Organism:
Location:
GL896999.1:3409264-3409677 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
78.57 %
Coverage:
97.89 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
TOMM22
Parental gene aliases:
No gene alias available
Parental gene description:
translocase of outer mitochondrial membrane 22 homolog (yeast) [Source:HGNC Symbol;Acc:18002]

Genomic region (view in browser)





>retro_mputfur_1038
GCCGCCTCTGCCAGCGGCCCTGGGGTGCCCCTGTCCCTGGACCAATGGCTTCCGAAAGGC
CATTCTGAGAAGACTGAGGAGGAGCTGGATGAGCAGGATGAGGAACTAGATGAGACCCTG
TCTGAGAGACTGTGGGGGCTGACAGAGATGTTCCCAGAGAGGGTCCTGTCCACAGCTGGA
GCCACTTTGGATCTCTCCCTCTTTGTGGCTCAGAAAATGTGCAGGTTTTCCAGGGCAGCC
GTGTGGGTTGGGACTACTTCCTTCACGCTCCTAGTTCTTCTGTTGTCTTTGAGACTGAGA
AGCTACAAGTGCAAGAGCAGCAAGAACTGCGACAGCAGCAGATGCTTCTAGGGCCTAACC
CAGGGCTCTCAGGAGGAACGCCAGGGGCTCTCTCTTCACTTCCTGGAAAGATC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AAAAGGPGAPLSPDELLPKGDSEKTEEELEEEDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVL-PVVFE
AA.A.GPG.PLS.D..LPKG.SEKTEEEL.E..DEELDETLSERLWGLTEMFPERV.S.AGAT.DLSLFVAQKM.RFSRAA.W.GTTSF..LVL..VVFE
Retrocopy
AASASGPGVPLSLDQWLPKGHSEKTEEELDEQ-DEELDETLSERLWGLTEMFPERVLSTAGATLDLSLFVAQKMCRFSRAAVWVGTTSFTLLVL/SVVFE


Parental protein
TEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI
TEKLQ...QQ.L.Q.Q.LLGPN.GLSGG.PGAL.SLPGKI
Retrocopy
TEKLQVQEQQELRQQQMLLGPNPGLSGGTPGALSSLPGKI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide