RetrogeneDB ID:
retro_mputfur_1040
Organism:
Location:
GL896999.1:7051775-7052608 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
74.38 %
Coverage:
91.12 %
Frameshifts:
3
Stop codons:
5


Parental gene:
Parental gene symbol:
GULP1
Parental gene aliases:
No gene alias available
Parental gene description:
GULP, engulfment adaptor PTB domain containing 1 [Source:HGNC Symbol;Acc:18649]

Genomic region (view in browser)





>retro_mputfur_1040
ATAATGCAGTTTCTTGGCAGTACAGAAGTGGAGCAGCCTAAAGGAACAGAAGTTGTGGGA
GGTGCTGTCAGAAAACTCAATTTTCCAAGACCTATCAAGAAATCGGAAGGCCAGAAAATT
CCTCAAGTTGAGCTGCAAATACCAGTACATGGAGTCAAAGTTCCAGAACCGAAAACAAAG
GAAGGCCAACACAATTTCCAGCTTCATAGAATATTCTTTTGTGCAGATGACAAAACTGAC
AAGAGGATATTCACTTTCATATGTAAAGATTCTGAGTCAAATAAATATTTGTGTTGTGTA
TTTGACAATTAAAATTGTGCTCAAGAAATAACTTTAGGAATTGGCCAAGCATTTGACCTG
GCATACAGGAGATTTCCAGAATCTGGAGGAAAAGATGTTGAAACAAGAAAACATATTGCA
AGATTACAGAAAAGAATTCAAGACTTAGGAACTGAAAATATGGAACTTAAAAAAAAAGTG
CAAGATTTGGAAAGCCAGTTAAGAATAACCTAAGTATCAACATCTCCAGCGTCAGTGTGA
CACCTAAGTCACCCTCCACTGACATCTTTGATACGATACCATTTTCTCCAATATCATACA
CATCTTTGACATCTACTCGCAATGGGACATAGCTACCTCCAATACCTAGTAGATCAACTG
AGATCAACGGAACTCATTTAGAGCAGAACCCTTTGACCCATTTAACTGTGGAGCAGGGGT
TTTCCCTCTCAATTTCCATCAGTCAAAATTAGAGGAGATGCAGGAGTGATTCAGAATGCG
ACTAACTCCTGGAAGGCACAGTCTTTTATCTTGAAACATGAGATAGTAGGTGC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LRKFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKIPKVELQISIYGVKILEPKTKEVQHNCQLHRISFCADDKTDKRIFTFICKDSESNKHLCYV
...FLGSTEVEQPKGTEVV..AVRKL.F.R.IKKSEGQKIP.VELQI...GVK..EPKTKE.QHN.QLHRI.FCADDKTDKRIFTFICKDSESNK.LC.V
Retrocopy
IMQFLGSTEVEQPKGTEVVGGAVRKLNFPRPIKKSEGQKIPQVELQIPVHGVKVPEPKTKEGQHNFQLHRIFFCADDKTDKRIFTFICKDSESNKYLCCV


Parental protein
FDSEKCAEEITLTIGQAFDLAYRKFLESGGKDVETRKQIAGLQKRIQDLETENMELKNKVQDLESQLRTTQVSASPAG-TGTPKSPSTDIFDMVPFSPVS
FD...CA.EITL.IGQAFDLAYR.F.ESGGKDVETRK.IA.LQKRIQDL.TENMEL...VQDLESQLR.T.VS.SPA....TPKSPSTDIFD..PFSP.S
Retrocopy
FDN*NCAQEITLGIGQAFDLAYRRFPESGGKDVETRKHIARLQKRIQDLGTENMELXXXVQDLESQLRIT*VSTSPAS/SVTPKSPSTDIFDTIPFSPIS


Parental protein
HVTSTPARNGTQPPPVPSRATEI-KRDLFGAEPFDPFTCGAGDFPPDI-ESKLEEMQEGFKMGLT-LEGTVFCLDPLDSRC
....T..RNGT..PP.PSR.TEI..R..F.AEPFDPF.CGAG.FP.....SKLEEMQE.F.M.LT.LEGTVF.L...DSRC
Retrocopy
YTSLTSTRNGT*LPPIPSRSTEI/QRNSFRAEPFDPFNCGAGVFPLNFHQSKLEEMQE*FRMRLT\LEGTVFYLET*DSRC


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide