RetrogeneDB ID:
retro_mputfur_1046
Organism:
Location:
GL897001.1:2057442-2057740 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
63.11 %
Coverage:
61.35 %
Frameshifts:
2
Stop codons:
3


Parental gene:
Parental gene symbol:
ARL2BP
Parental gene aliases:
No gene alias available
Parental gene description:
ADP-ribosylation factor-like 2 binding protein [Source:HGNC Symbol;Acc:17146]

Genomic region (view in browser)





>retro_mputfur_1046
CCTGTTTGTAATGAGTATATGTCTTTGGTAGAAAAGTATATTGAAGAACATCTGCTAGAG
CAGATTCCTGGATTTAACATGTGACTCGCACAGCGTCTTTCTAGCACTGCGAAGATGAAG
TAGCTCGTGATATATTGGGCATGCTGTTCATGTTTACAGCTTTTCTGGCTTTTTAAAAGA
AATGTTTCTGGGTTATAGAGCAGAAAAAGACGGCTGGGGACTGGGTTTAAGGAGCAATTT
AGTGGTGACTTTGTGATGCAACTCATCTTTATCAGCTTCCCAGACAGATCTGAGGCCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PIFNEYISLVEKYIEEQLLERIPGFNM-AAFTTTLQHHKDEVAGDIFDMLLTFTDFLAF-KEMF-LDYRAEKEGRGLDLSSGLVVTSLCKSSSVPASQND
P..NEY.SLVEKYIEE.LLE.IPGFNM....T....H..DEVA.DI..ML..FT.FLAF.K..F.L.YRAEK.G.GL.L.S.LVVT..C..SS..ASQ.D
Retrocopy
PVCNEYMSLVEKYIEEHLLEQIPGFNM/VTRTASF*HCEDEVARDILGMLFMFTAFLAF*KKCF/LGYRAEKDGWGLGLRSNLVVTL*C-NSSLSASQTD


Parental protein
LRP
LRP
Retrocopy
LRP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide