RetrogeneDB ID:
retro_mputfur_1047
Organism:
Location:
GL897001.1:1931195-1931717 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
74.58 %
Coverage:
51.49 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
CDC123
Parental gene aliases:
No gene alias available
Parental gene description:
cell division cycle 123 [Source:HGNC Symbol;Acc:16827]

Genomic region (view in browser)





>retro_mputfur_1047
ATCAAGAAGGAACATGTGCTGCACTGTCAGTTCTCTGTGTGGCAGCCGCTGTTCGGAAGC
CTTACCATTACGTGTCATTCTTCCACTCCTCAGAATGTGAAGGGTTATTTACTTGATGAT
GGAACTCTGGTGGTTTCAGGATGAGAAGATCCGCCAACAAGTTCTTAGCCAAACAGTGAT
AATAAGGCAGAAGAAATACAGTGGTCGGATGATGAGAACACAGATACCCTTATGGCACCA
GGATTTCCCAAAGTCACCACTAAAGGTCAAGAAGCTACCAACTCCTGTGTATGGGGGGGG
GGTGTATTTCCTAAACTTAACTGGAGTGCCCCATGGGATATGTACTGGATAGCAATGAAC
AGTTCTCTGAAATGTAAAGCCCTCAGTGAAGTCTTTCTACTGTTCAAGAGTTCTGATTTC
ATCACTCACAACTTTATTCAACCATTTTTTCATTGTACTGATGATTCTCCACATCTCTGT
ATAGAATATGAGCTTATTCTTGGAAAATGGTATGAATTGATT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MKKEHVLHCQFSAWYPLF-RSLTIKSVILPL-PQNVKDYLLDDGTLVVSGREDPPTHSQPDSDDEAEEIQWSDDENTATLTAPEFPEFTTKVQEAINSL-
.KKEHVLHCQFS.W.PLF...L....VILPL.PQNVK.YLLDDGTLVVSG.EDPPT.S.P.SD..AEEIQWSDDENT.TL.AP.FP..TTK.QEA.NS..
Retrocopy
IKKEHVLHCQFSVWQPLF\EALPLR-VILPL/PQNVKGYLLDDGTLVVSG*EDPPTSS*PNSDNKAEEIQWSDDENTDTLMAPGFPKVTTKGQEATNSCV


Parental protein
-GGSVFPKLNWSAPRDAYWIAMNSSLKCKTLSDIFLLFKSSDFITRDFTQPFIHCTDDSPDPCIEYELVLRKWCELI
....VFPKLNWSAP.D.YWIAMNSSLKCK.LS..FLLFKSSDFIT..F.QPF.HCTDDSP..CIEYEL.L.KW.ELI
Retrocopy
XXXXVFPKLNWSAPWDMYWIAMNSSLKCKALSEVFLLFKSSDFITHNFIQPFFHCTDDSPHLCIEYELILGKWYELI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide