RetrogeneDB ID:
retro_mputfur_1048
Organism:
Location:
GL897001.1:1933712-1935194 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
82.66 %
Coverage:
76.16 %
Frameshifts:
2
Stop codons:
4


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
Heat shock cognate 71 kDa protein [Source:UniProtKB/TrEMBL;Acc:G9K4X7]

Genomic region (view in browser)





>retro_mputfur_1048
TCAATTGGCATTGATTTTGGCACTACCTACTCCTGCGTGGGTGTCTTCCAGCATGGGAAA
GTGGAAATAATGGCCAGTGATCAGGAAAACCGAACCACCCCAAGTTATGTCACCTTCATG
GACACTGAATGATTGATCGGTGACACTGCAAAGAATCAAGTTGTGATGAACCCCACCAGC
ACAGATTTTGAAGCCAAATGCCTGATTAGACAGAAATTTGATGATGCTGTTGTCCAATCT
GATACGAAGCATTGGCCTTTCATGGTGGTGAATGATGCTGACAGGCCCAAGGTCTAAATA
GAATACAAGGGAGAGACAAAAAGCTTCTATTCAGAGGAGGTGTCTTCTATGGTTTTGATG
AAAATGAAGGAAATTACAGAGGCTTATCTTGAGAAGACAGTTACCAATGCAGTTGTCACA
GTACCTGTGTACTTCAATGATTCTCAGCGTCAGGCTACCAAAGATGCTGGAACTATTGCT
GGTCTCAATATACTTTGAATCATCAATGAGCCAACTGCTGGTGCTATTGCTTATGGCTTA
GACAAAAGAGTTAGAGCTGAAAGGAATGCGCTGATCTTTGACTTAGGAGGTGACACTTTT
GATGTGCTAATCCTTACTACAGAAGATGGTATCTTTCAGGTTAAGTGCACAGTTGGAGAC
ACCCACCACTTCTTAGGTGGAGAAGACTTTGACAACTGAATGGTCAACCATTTTATTGCA
GAGTTCAAGCGCAAACATAAGAAATATATCAGTGAAAACAAAGGGGAAGTTCGTCATCTC
TGTACTGCTTGTGAATGTGCTAAGCGTACACTTTCTTCCAGCACCCAGGCCAGTATTGAG
ATTGATTCTCTGTATGAAGGAATCAACTTCTATACTTCTATCACTCATGCTGGGTTTGAA
GAATTAAATGCTGACCTGTTTTGTGGCACCCTGGACCCTGTAGAGAAAGCCCTTCAGGAT
GCAAGTTACACAAGTCTCAGATCCACGATACTGTCCTGGTGGGTGTTTCTACCCATATCC
CCAAGACTCAGAAACTTCTCCAAGATTTCTTCCGTGGAAAAGAACTGAATAAGAGCATCA
ACCCTGACGAGGCTGTTGCTTATGGTGCAGCTGTCCAGGCAGCCATCCTTTCTGGAGACA
AACCTGGAAATGTTCAAGGTTTGCTGTTGTTGGATGTCATTCCACTTTCTCTTGGCATAG
AAACTGCTGGACAAGTCATGACTGTTCTCATTAAGCATAATACTACCATTTCTACCAAAC
AGACACAGATCTTCACTACCTACTCCGACAACCAGCCTGGTATGCTTATTCAGGTGTATG
AAGGTAGAGCGTGCCATGACCAAGGACAACATCCTATTTAGAAAGTTTGAACTCACAGGC
ATACCTCCTGCCCCTCGTGGTGTCCCATTGATTGAGGTCACTTTTGATATTGATGCTAAT
GGTATCCTCAAAGAGAACAAGATTACCATCACTAATGACAAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQV
..GID.GTTYSCVGVFQHGKVEI.A.DQ.NRTTPSYV.F.DTE.LIGD.AKNQV.MNPT.T.F.AK.LI...FDDAVVQSD.KHWPFMVVNDA.RPKV..
Retrocopy
SIGIDFGTTYSCVGVFQHGKVEIMASDQENRTTPSYVTFMDTE*LIGDTAKNQVVMNPTSTDFEAKCLIRQKFDDAVVQSDTKHWPFMVVNDADRPKV*I


Parental protein
EYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTF
EYKGETKSFY.EEVSSMVL.KMKEI.EAYL.KTVTNAVVTVP.YFNDSQRQATKDAGTIAGLN.L.IINEPTA.AIAYGLDK.V.AERN.LIFDLGG.TF
Retrocopy
EYKGETKSFYSEEVSSMVLMKMKEITEAYLEKTVTNAVVTVPVYFNDSQRQATKDAGTIAGLNIL*IINEPTAGAIAYGLDKRVRAERNALIFDLGGDTF


Parental protein
DVSILTIEDGIFEVKSTAGDSH--LGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKCTLSSSTQASIEIDSLYEGIDFYTSITRARFE
DV.ILT.EDGIF.VK.T.GD.H..LGGEDFDN.MVNHFIAEFKRKHKK.ISENK..VR.L.TACE.AK.TLSSSTQASIEIDSLYEGI.FYTSIT.A.FE
Retrocopy
DVLILTTEDGIFQVKCTVGDTHHFLGGEDFDN*MVNHFIAEFKRKHKKYISENKGEVRHLCTACECAKRTLSSSTQASIEIDSLYEGINFYTSITHAGFE


Parental protein
ELNADLFRGTLDPVEKALRDA-KLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLG
ELNADLF.GTLDPVEKAL.DA.KL.KSQIHD.VLVG.ST.IPK.QKLLQDFF.GKELNKSINPDEAVAYGAAVQAAILSGDK..NVQ.LLLLDV.PLSLG
Retrocopy
ELNADLFCGTLDPVEKALQDA/KLHKSQIHDTVLVGVSTHIPKTQKLLQDFFRGKELNKSINPDEAVAYGAAVQAAILSGDKPGNVQGLLLLDVIPLSLG


Parental protein
IETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEG-ERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGK
IETAG.VMTVLIK.NTTI.TKQTQ.FTTYSDNQPG.LIQVYEG.ERAMTKDN.L..KFELTGIPPAPRGVP.IEVTFDIDANGIL..........K
Retrocopy
IETAGQVMTVLIKHNTTISTKQTQIFTTYSDNQPGMLIQVYEG\ERAMTKDNILFRKFELTGIPPAPRGVPLIEVTFDIDANGILKENKITITNDK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide