RetrogeneDB ID:
retro_mputfur_1049
Organism:
Location:
GL897002.1:4745824-4746135 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
66.67 %
Coverage:
59.09 %
Frameshifts:
1
Stop codons:
3


Parental gene:
Parental gene symbol:
MAP1LC3A
Parental gene aliases:
No gene alias available
Parental gene description:
microtubule-associated protein 1 light chain 3 alpha [Source:HGNC Symbol;Acc:6838]

Genomic region (view in browser)





>retro_mputfur_1049
GCTGACCACTATAAGGAGGTGTAGCATATTCACGACCAGCAACCCAGCAAGATCCTGATG
ATCACTGAGTGCTAAAGAGTGAGAAGGAGCTGCCCATCCTGGACAAGACCAAGTTCCTGA
TCCCAGACCATGTCAACCAGTGTTAATTGATCAAGATGATCCAGCCTTGTCCACAGCTGA
ATCCCATGTAGGCCTTCTTCCTGCTGGTGAACCGGCACCACATGGTGAGCGTGCCCACGC
CTATTCTGGACATGTATGTGCAGGAGAAGGATGACCCTGGCTTCCTCTACATGGTCTACA
CCTCCCAGGAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ADRCKEVQQIRDQHPSKIPVIIER-YKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDDDGFLYMV
AD..KEV..I.DQ.PSKI..I.E...K.EK.LP.LDKTKFL.PDHVN...L.K.I....QLNP..AFFLLVN.H.MVSV.TPI.D.Y.QEKDD.GFLYMV
Retrocopy
ADHYKEV*HIHDQQPSKILMITEC/LKSEKELPILDKTKFLIPDHVNQC*LIKMIQPCPQLNPM*AFFLLVNRHHMVSVPTPILDMYVQEKDDPGFLYMV


Parental protein
YASQE
Y.SQE
Retrocopy
YTSQE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide