RetrogeneDB ID:
retro_mputfur_1052
Organism:
Location:
GL897002.1:5268347-5268850 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
63.58 %
Coverage:
100.0 %
Frameshifts:
4
Stop codons:
2


Parental gene:
Parental gene symbol:
DTD2
Parental gene aliases:
No gene alias available
Parental gene description:
D-tyrosyl-tRNA deacylase 2 (putative) [Source:HGNC Symbol;Acc:20277]

Genomic region (view in browser)





>retro_mputfur_1052
CTGGATGAGAATGGGGGGATACCTCAAGCCCCTGGTGGTTCTGCAGCACTACCTGCACAC
CTAGTTGCAAGTAAACCCAGCTGAGGGGTCACCAAGACCCAGTGGGTGGGAGTTCAGAGA
GGTTTAATGATGTGTGTGTGTGTGTTTTCCAAGGGAACTAATAAAGAACTTCTTCCCCAA
ATTGTTGATACACTGCTAAATATGAAATTAAGGGAAACAGAAAAAGGCAAGCCTATATCA
GGTCTACCTGGCAATGTTCTTATCATCCTTTAAGCCACCCTCAGGAGGGGAGAGTAAAAG
AAGAAACATGCAGTATCACTCTAACTCTGGAAAAGAGAGAAGGGTTAGAACTTTATTTTC
GATTTGTGATTCTAAGTGAGAAGAAATTTGCTGCTAACAGCAAGAGCCCCAAACCTGGAG
TTGTGGTAGAACACGGTACGTACAGAAATAGACAGGTGTCAAAGCTGTATACCAGTGGAC
CATACACACACCTAACTGAGTTT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MTESGRIPQARA-LLQQCLHARLQVRPAEED-AESQWVEVQRGLVIYVCFF-KGANKELLPKMVNTLLNVKLSETENGKHVSILDLPGNVLIIPQATL-G
..E.G.IPQA....LQ..LH..LQV.PAE......QWV.VQRGL........KG.NKELLP..V.TLLN.KL.ETE.GK..S...LPGNVLII..ATL.G
Retrocopy
LDENGGIPQAPG\VLQHYLHT*LQVNPAEGS/TKTQWVGVQRGLMXXXXXXSKGTNKELLPQIVDTLLNMKLRETEKGKPIS--GLPGNVLIIL*ATL\G


Parental protein
GRVKGRNMQYHSNSGKE-EGLELYSQFVTLCEKELAANSKCAEAGVVVEHGTYGNRQVLQLDTNGPYTHLIEF
G..K.RNMQYHSNSGKE.EGLELY..FV.L.EK..AANSK....GVVVEHGTY.NRQV..L.T.GPYTHL.EF
Retrocopy
GESKRRNMQYHSNSGKE\EGLELYFRFVILSEKKFAANSKSPKPGVVVEHGTYRNRQVSKLYTSGPYTHLTEF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide