RetrogeneDB ID:
retro_mputfur_1057
Organism:
Location:
GL897003.1:1380961-1381438 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
62.96 %
Coverage:
59.04 %
Frameshifts:
2
Stop codons:
4


Parental gene:
Parental gene symbol:
OTUB1
Parental gene aliases:
No gene alias available
Parental gene description:
OTU domain, ubiquitin aldehyde binding 1 [Source:HGNC Symbol;Acc:23077]

Genomic region (view in browser)





>retro_mputfur_1057
CTGGCCTATGATGAAGATACCGTGGCTCAGCAGGACTAAATTCAATAAAAGATTGCTGTG
CAGAACCCTCTGTTCTTGGAGCTGTTGGAGCTGACATTCTGTACAGGGAGTACGCTGAGG
ATGACATCTGTCAACAGAAGATTGAGCATCTTTACCAAAAATTCTTGTACATCTATAAGA
CCAGGCTTTATGTGAACTGCTTCTCTTGCGCTTCTGGATGCTTGCACCTGGAGGTGCTGC
TGAATGTGAGCAAGGAGTTTTAGCAATTCAAGCCTGTGTCTGCCAAGATCAAAGAGAACC
TCGTCTCCCAGGCCTTTACTGAGTTCACGGTTTAAACATTTCCACCCATGTTTTACAGAC
CTGATTGAGCAGATGGAGAAGCATACCTCAGTAGTCAATCTTTTGGCCTCCTTCAGCAGC
TAGGGGACCTTGGATTTCCTGTTAGTCTCTCTGCAACTGCTCACCTCAGGCTACCTA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LAYDEAIMAQQDRIQQEIAVQNPLVSERLELS-VLYKEYAEDDNIYQQKIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAKSK
LAYDE...AQQD.IQ..IAVQNPL..E.LEL...LY.EYAEDD.I.QQKI..L..K..YI.KTR...NCF..A.G..HLE.LL..SKE...FK.VSAK.K
Retrocopy
LAYDEDTVAQQD*IQ*KIAVQNPLFLELLELT/ILYREYAEDD-ICQQKIEHLYQKFLYIYKTRLYVNCFSCASGCLHLEVLLNVSKEF*QFKPVSAKIK


Parental protein
EDLVSQGFTEFTI-EDFHNTFMDLIEQVEKQTSVADLLASFNDQSTSDYLVVYLRLLTSGYL
E.LVSQ.FTEFT....FH..F.DLIEQ.EK.TSV..LLASF....T.D.L.V.L.LLTSGYL
Retrocopy
ENLVSQAFTEFTV\KHFHPCFTDLIEQMEKHTSVVNLLASFSS*GTLDFLLVSLQLLTSGYL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide