RetrogeneDB ID:
retro_mputfur_1058
Organism:
Location:
GL897004.1:945416-945829 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
62.68 %
Coverage:
60.78 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
CACYBP
Parental gene aliases:
No gene alias available
Parental gene description:
calcyclin binding protein [Source:HGNC Symbol;Acc:30423]

Genomic region (view in browser)





>retro_mputfur_1058
ATGGCTTCAGCTTCGGAAGAGCTAGCAAGGGGTCTGGAAGGGGTGAAGGTGGAAAAGCCC
ACCAGAAAAGACGATATGATGCCCTTACAGCTCAAACATCCAAGATCCAGACAGAAATCA
AGAACAAGATGCAGCAGAAATCAGAAAAGCAGAACCTCTTGACAGTGAGAAAGCCAGATG
CCATGGTCGCTTCTGTTCTAATGGGATATGCAGTGAAAATCATTAATTACAGATGGGAGC
AGTCAGAGAAGTTTGTGGAAATCTGTATCACCTTAACCAGAGTTCATCAAGCCCCCACTG
AGAATGTGCAAGCGCCCTTCACAGTAAGGTCATTTGATCTTCTGGCAAATAATCTAAATG
GGAAGACTTACCCCACAACAGGGAACAATCTCTTGAAACCCATCTCCATGGAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LSSVLTQLQKDLEEVKVLLEKTSRK-RVRDALTAEKSKIETEIKNKMQQKSQRKAELLDNEKPAAVVAPITTGYTVKISNYGWDQSDKFVKIYITLTGVH
..S....L...LE.VKV..EK..RK.R..DALTA..SKI.TEIKNKMQQKS..K..LL...KP.A.VA....GY.VKI.NY.W.QS.KFV.I.ITLT.VH
Retrocopy
MASASEELARGLEGVKV--EKPTRK/RRYDALTAQTSKIQTEIKNKMQQKSE-KQNLLTVRKPDAMVASVLMGYAVKIINYRWEQSEKFVEICITLTRVH


Parental protein
QVPTENVQVHFTERSFDLLVKNLNGKSYSMIVNNLLKPISVE
Q.PTENVQ..FT.RSFDLL..NLNGK.Y....NNLLKPIS.E
Retrocopy
QAPTENVQAPFTVRSFDLLANNLNGKTYPTTGNNLLKPISME


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide