RetrogeneDB ID:
retro_mputfur_1059
Organism:
Location:
GL897004.1:1073942-1074307 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
58.59 %
Coverage:
99.22 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
Gm11808
Parental gene aliases:
No gene alias available
Parental gene description:
predicted gene 11808 [Source:MGI Symbol;Acc:MGI:3649356]

Genomic region (view in browser)





>retro_mputfur_1059
CAGACCTTTATGAAGACCCTGACAGGCAAGACCACCACCCTTAACTATGAGCCCAGCGAC
ACCAAAACCAAAATCAGAGATGAGGAGGGCATCCTGCCTAACTAGCAGCATCCAACTTTG
GGGAGCAAACAGCTGGAGGATAACCACACTTTCTCAGACTACAATATCCAGAAAGAATCT
ACCCTGTACTTGGTACTTCACCTGCAGGGTGGCATCACTGAGCTGTTCCTCTGCCAGCTG
GCGCAGAAATACAACTGTGACAAGATGATCTGCTTCTAGCGTCATGCCCATCTACACCCT
GTGCTATCAACTGCCACAAGCAGGTGGCCACCCCAACAACCTGCACCCCAAGAAGTAAAA
TAAGG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYA
Q.F.KTLTGKT.TL..EPSDT....K.KI.D.EGI.P..Q......KQLED..T.SDYNIQKESTL.LVL.L.GGI.E..L.QLAQKYNCDKMIC....A
Retrocopy
QTFMKTLTGKTTTLNYEPSDT----KTKIRDEEGILPN*QHPTLGSKQLEDNHTFSDYNIQKESTLYLVLHLQGGITELFLCQLAQKYNCDKMICF*RHA


Parental protein
RLH-PRAVNCRKKKCGHTNNLRPKKKVK
.LH.P.A.NC.K.....T....P..K..
Retrocopy
HLH/PCAINCHKQVATPT-TCTPRSKIR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide