RetrogeneDB ID:
retro_mputfur_1061
Organism:
Location:
GL897004.1:6871115-6871463 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
72.5 %
Coverage:
51.32 %
Frameshifts:
3
Stop codons:
0


Parental gene:
Parental gene symbol:
CMPK1
Parental gene aliases:
No gene alias available
Parental gene description:
cytidine monophosphate (UMP-CMP) kinase 1, cytosolic [Source:HGNC Symbol;Acc:18170]

Genomic region (view in browser)





>retro_mputfur_1061
GTGGCTGTCAATGCTCAGAAGAAACATTTCTCGATTGATGGGTTCCAAGAAATCAAGACA
ATCTTCAAGGTTGGAGCAAGACCATGGATGGAAAGGCATGGGTGTCTTTGGTTCTGTTTT
TTGACTGTAATAATGAGATCTTACTGAACGATGTCTTAGAAGGGGAAAGAGTACTTGGTA
GAAGTGATGACAACAGAGAGCTTGGAAAAGAGAATTCGGACCTATCTTCAGTCGATAAAG
CCAATTATTGACTTCTACGAAGTGATGGGGAAAGCCAAGAAAATAGCTGCGTCTAAGTGT
ACTGATGAAGTTTTTGATGAAGTTGTGAAGACTTCGGACAAAGAAGGC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAANAQKNKFLIDGF-PRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICI-ERCLER-GKSSGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKKID
.A.NAQK..F.IDGF.PRNQDNLQGW.KTMDGKA.VS.VLFFDCNNEI...ERCL.R.GK.........ESLEKRI.TYLQS.KPIID.YE.MGK.KKI.
Retrocopy
VAVNAQKKHFSIDGF/PRNQDNLQGWSKTMDGKAWVSLVLFFDCNNEILL/ERCLRR/GKEYLVEVMTTESLEKRIRTYLQSIKPIIDFYEVMGKAKKIA


Parental protein
ASKSVDEVFDEVVKIFDKEG
ASK..DEVFDEVVK..DKEG
Retrocopy
ASKCTDEVFDEVVKTSDKEG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide