RetrogeneDB ID:
retro_mputfur_1063
Organism:
Location:
GL897004.1:2790924-2791185 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
63.22 %
Coverage:
87.88 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
DPY30
Parental gene aliases:
No gene alias available
Parental gene description:
dpy-30 homolog (C. elegans) [Source:HGNC Symbol;Acc:24590]

Genomic region (view in browser)





>retro_mputfur_1063
GAACTGGAGCAGATGATGAAGGGAGAGATGCAGGTTCCAGAAAACCCTCACTCTAAGGAC
TGTCTCATAGACAGTGTTGACAGGATAGTAGATAAGGAGAAGACTCCTACAGGAAGGTCA
TCAAAACAGAAAGCAGCTCTCTAGTCTTTGCCAACTTGTACCTAACTGGATCAGACAGTT
ATGCCCATTTTGTTAACGGGAACTTCTGTGCTTGCAAAAGGAAGACCACCAAATCCCACT
AAATTTCTAGCATTGTATCTT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EPEQMLEGQTQVAENPHSEYGLTDNVERIVDNEKINAEKSSKQKVDLQSLPTRAYLDQTVVPILLQGLAVLAKERPPNPIEFLASYL
E.EQM..G..QV.ENPHS...L.D.V.RIVD.EK.....SSKQK..L.SLPT...LDQTV.PILL.G..VLAK.RPPNP..FLA.YL
Retrocopy
ELEQMMKGEMQVPENPHSKDCLIDSVDRIVDKEKTPTGRSSKQKAAL*SLPTCT*LDQTVMPILLTGTSVLAKGRPPNPTKFLALYL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide