RetrogeneDB ID:
retro_mputfur_1065
Organism:
Location:
GL897005.1:2846011-2846270 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
55.56 %
Coverage:
58.39 %
Frameshifts:
3
Stop codons:
1


Parental gene:
Parental gene symbol:
DNAJC15
Parental gene aliases:
No gene alias available
Parental gene description:
DnaJ (Hsp40) homolog, subfamily C, member 15 [Source:HGNC Symbol;Acc:20325]

Genomic region (view in browser)





>retro_mputfur_1065
CAAGTCTGGAACCTTCTGCAACAAGTAATCATAGAAGAAGTGAAAATTTCAACCCTGAGG
CTTTCATCTCCCCTATAAAAAAGAATTTAAACAGAAAAACCAGTAGGCGAGAAGCTAGTC
TTATTTTAGGTGTAAGCCCATCTGCTGGCAAAGCCTAGATTAGAACAGTTCAGAGGGAAA
TCATGATTTCAAATTCAGCAGATAACAGTGACGCAGCTCTTTAGCAACCCAAATATATAA
AGTAGAAGTCATGCTAGAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QIWKPLEQVITETAKKISTPSLSSY-YKGGFEQK-MSRREASLILGISPSAGKAKIRTAHRRIMILNHPDKGGSPY-LATKINEAKDLLE
Q.W..L.QVI.E..K.IST..LSS..YK..F.QK..SRREASLILG.SPSAGKA.IRT..R.IMI.N..D.......LAT.I......L.
Retrocopy
QVWNLLQQVIIEEVK-ISTLRLSSP\YKKEFKQK\TSRREASLILGVSPSAGKA*IRTVQREIMISNSADNSDAAL/LATQIYKVEVMLD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide