RetrogeneDB ID:
retro_mputfur_1066
Organism:
Location:
GL897005.1:5403140-5403511 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
51.97 %
Coverage:
54.82 %
Frameshifts:
1
Stop codons:
4


Parental gene:
Parental gene symbol:
RPE
Parental gene aliases:
No gene alias available
Parental gene description:
ribulose-5-phosphate-3-epimerase [Source:HGNC Symbol;Acc:10293]

Genomic region (view in browser)





>retro_mputfur_1066
ATTGTATCCAGCTGTAAAATTGGCCTGACCAGTCTCAACAGCAATTTAATTAGCCTAGAG
ACCAAAGGTATTCACACTTTAGACTCTGAAGCTGATTATCTGCATTAGGATGTGTTAGAC
AGGCAGTTTGTTCCCTAGGTTATCATCATTGGTCACCCCAGAAGTCTTCAGAAACAACTG
GACAAGGACTCTTTCTTTGACATCTCTATGATTGTCTCTAGGACAGAACAGCATATAAAG
ACAATAGCTATAGCAGGAACAAATTAAAATGATTTTCATCTTGAAGTTATTGAGAAACCA
GGAGCTGTTTTATAGATATAGAGTAGAATTGGATGAAGTTCAATCTCACTATTAAAATAG
CAACTACAATG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVP-NITFGHPVVESLRKQLGQDPFFDMHMMVSRPEQWVKPMAVAGANQYTFHLEATE
..S.CKIG...LNS.L..L.......LDS.ADYLH.DV.D..FVP..I..GHP...SL.KQL..D.FFD..M.VSR.EQ..K..A.AG.N...FHLE..E
Retrocopy
IVSSCKIGLTSLNSNLISLETKGIHTLDSEADYLH*DVLDRQFVP*VIIIGHP--RSLQKQLDKDSFFDISMIVSRTEQHIKTIAIAGTN*NDFHLEVIE


Parental protein
NPGALI-KDIRENGMKVGLAIKPGTTV
.PGA....DI..N.MK..L.IK..TT.
Retrocopy
KPGAVL/IDIE*NWMKFNLTIKIATTM


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide