RetrogeneDB ID:
retro_mputfur_1071
Organism:
Location:
GL897006.1:1971231-1971583 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
63.33 %
Coverage:
90.08 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
RPS19
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S19 [Source:HGNC Symbol;Acc:10402]

Genomic region (view in browser)





>retro_mputfur_1071
ATGGCTGGAGTTACTGTAAGAGACCTGAACCTGCAGGAGTTCATCAGAGCTCTGGCAGCC
TTCCTCAAAAAGTTTGGAAAGCTGAAGTTTCCTAAATGGGTGGACTTGGTCAAGCTGCCT
GAGTGTATAGATCTTGTTCTCTGTGATGAGAACTGGTTCCACAGATGAGCCACTTCCACA
GAGCAATGCCTGTATCTCTCGGGCTGCACCAGGTTGGCTCCATGACCAAGATCTATGGGG
GACATTAGAGAAACAGCATCGCACCCAGCTCCTCAGTCGATGCTCCAAGAATGTGGCCCA
CAGGGTCCTCCAAGCCCTGGAGGGGCTGAAAGTTACAGACAAGAACCAAGAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MPGVTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYDENWFYTRAASTARHLYLRGGA-GVGSMTKIYGGRQRNGVMPSH-FSRGSKS
M.GVTV.D.N.QEF.RALAAFLKK.GKLK.P.WVD.VKL.....L...DENWF...A.ST...LYL.G....VGSMTKIYGG..RN...PS...SR.SK.
Retrocopy
MAGVTVRDLNLQEFIRALAAFLKKFGKLKFPKWVDLVKLPECIDLVLCDENWFHR*ATSTEQCLYLSGCT/QVGSMTKIYGGH*RNSIAPSS/LSRCSKN


Parental protein
VARRVLQALEGLKMVEKDQD
VA.RVLQALEGLK...K.QD
Retrocopy
VAHRVLQALEGLKVTDKNQD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide