RetrogeneDB ID:
retro_mputfur_1073
Organism:
Location:
GL897007.1:1203101-1203868 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
87.94 %
Coverage:
71.63 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
RFC3
Parental gene aliases:
No gene alias available
Parental gene description:
replication factor C (activator 1) 3, 38kDa [Source:HGNC Symbol;Acc:9971]

Genomic region (view in browser)





>retro_mputfur_1073
ATAAGCCTCTGGGTGAACAAATACCGGCCCTGCTCCTTGGGAAGGCTGGACTCTCACGAG
GAGCAGGCGGCCCAGCTGCGCAACCTGGTGCAGTGTGGTGATTTTCCTCATCTCTTAGTG
TATGGACCATCAGGGGCTGGAAAAAAGACAAGAATTATGTGTATTCTATGTGAACTTTAT
GGTGTTGGAGTCGAAACATTAAGAGTTGAACATCAGACCATCACAACTCCATCTAAAAAG
AAAATTGAAATTAGCACTATTGGGAGCAATTGAAGCACCTTGAAGTGAATCCCAGTGATG
CTGGAAATAGTGACCGGGTAGTAATTCAGGAGATGTTGAAAACAGTGGCATGATCACAGC
AACTTGAAACAAATTCTCAAAGAGATTTTAAAGTGGTATTATTGACAGAGGTTGTCAGAC
TCACCAAAGACGCTCAACATGCCTTGCGTAGGACCATGGAAAGGTATATGTCCACTTGTA
GATTGATCTTGTGTTGCAATTCTACATCTAAAGTGGTACCACCTATTCGCAGTAGGTGCC
TGCGGGTTCGTGTGCCTGCTCCCAACATCGAAGATATTCATCACGTATTATCTACTGTGT
GCAAGAAGGAAGGTTTGAATCTTCCTTCACAACTGGCTCATAGACTTGCAGAGAAGTCCT
GCAGGAATCTCCGTAAAGCTCTACTTATGTGTGAAGCCTGCAGAGAGCAACAATACCCTT
TTAGTGCAGATCAAGAAATCCCTGAAACAGATTGGGAGGTGTTATTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSLWVDKYRPCSLGRLDYHKELAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLRIEHQTITTPSK-KKIEISTIASNY-HLEVNPS
.SLWV.KYRPCSLGRLD.H.E.AAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCIL.ELYGVGVE.LR.EHQTITTPSK..K...........HLEVNPS
Retrocopy
ISLWVNKYRPCSLGRLDSHEEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILCELYGVGVETLRVEHQTITTPSK\RKLKLALLGAIE\HLEVNPS


Parental protein
DAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLST
DAGNSDRVVIQEMLKTVA.SQQLETNSQRDFKVVLLTEV..LTKDAQHALRRTME.YMSTCRLILCCNSTSKV.PPIRSRCL.VRVPAP.IEDI.HVLST
Retrocopy
DAGNSDRVVIQEMLKTVA*SQQLETNSQRDFKVVLLTEVVRLTKDAQHALRRTMERYMSTCRLILCCNSTSKVVPPIRSRCLRVRVPAPNIEDIHHVLST


Parental protein
VCKKEGLNLPSQLAHRLAEKSCRNLRKALLMCEACRVQQYPFSADQEIPETDWEVYL
VCKKEGLNLPSQLAHRLAEKSCRNLRKALLMCEACR.QQYPFSADQEIPETDWEV.L
Retrocopy
VCKKEGLNLPSQLAHRLAEKSCRNLRKALLMCEACREQQYPFSADQEIPETDWEVLL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide