RetrogeneDB ID:
retro_mputfur_1077
Organism:
Location:
GL897008.1:3564806-3565229 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
71.03 %
Coverage:
72.08 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
TMEM126A
Parental gene aliases:
No gene alias available
Parental gene description:
transmembrane protein 126A [Source:HGNC Symbol;Acc:25382]

Genomic region (view in browser)





>retro_mputfur_1077
ATGGAACATCATGAACCAGATGACATTGTCAAGAAGACTTCATTTTCAATATCATAACCA
GAAAAATTAACCAACTCCCATAAGCAGAAAGGAATCTGTTTGAACATGAATCAACATATG
TCAGACTTAATGCTGGTCTCCGCGGTCTAAGGGCAAATAGACTTTTTCGATGCATCTTAA
ATGTGACACAGGCTCGTAGAGCGGGGGCCTACCGATGGCAGTGAGCCCATTTTTGACTGC
ACACATATCTTACAAAGATTTTGTAGTTTACTTTTGAATACAGGTGATTTGAATTGTGAA
ACCTATATCAGAACACGGGACTGACTGATTGGTCTTGTTTTTGGTGGTCTGTACCCTGCT
ACCTTGGCTGTACCTGTGAATGGTGGCCTAGTAGCCAGGCATGGGTCAGCCCCGCTGTCA
GAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MENHEPHDTVK-ENLIFNIITRKINQLPEAERNLLEHGSAYVGLNAGLCGLIANSLFRRVLNVTQARIA-AGLPMSVIPFLTADLSYRGFV-SLPLITGD
ME.HEP.D.VK.E..IFNIITRKINQLP.AERNL.EH.S.YV.LNAGL.GL.AN.LFR..LNVTQAR.A..GLPM.V.PFLTA..SY..FV.SL.L.TGD
Retrocopy
MEHHEPDDIVK/EDFIFNIITRKINQLP*AERNLFEHESTYVRLNAGLRGLRANRLFRCILNVTQARRA/GGLPMAVSPFLTAHISYKDFV/SLLLNTGD


Parental protein
LNCETCTITRGGLVGLVLGGLYPIILAIPVNGGLAARYESAPLPE
LNCET...TR..L.GLV.GGLYP..LA.PVNGGL.AR..SAPL.E
Retrocopy
LNCETYIRTRD*LIGLVFGGLYPATLAVPVNGGLVARHGSAPLSE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide