RetrogeneDB ID:
retro_mputfur_1079
Organism:
Location:
GL897010.1:8152-8994 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
88.65 %
Coverage:
94.59 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
NDFIP2
Parental gene aliases:
No gene alias available
Parental gene description:
Nedd4 family interacting protein 2 [Source:HGNC Symbol;Acc:18537]

Genomic region (view in browser)





>retro_mputfur_1079
GTTCTGGGGCTCCACCTCGCGGCGGCGGACGCGGAGGCTTCCGCGGCTGCTGCGGGGGCG
GCAGGAAGTGAAGCGGCCCGGCCGGGCAACCGCGGCGGCAGAAACGGAGGCGGAAGGGGC
GCTGCGGCCACGACGTCCGCGACGGGGCTGGGCGAGGGGGGTCGAGCACCGAGAGGACTC
GCCCGCTCGGAAGCCGGATCCCGAGCCGGGCGGGATTGGATCATCACCAGCCGGGAACTG
GCCGCTACCAGGTGCTTCACGATGAAGAGGATAATTCCGAGTCATCTGCGGCAGAGCAGC
GATCAACGTCAAACGCAGCGCCGCCGAGCGTTCAGACGGCTCCTTCAGCATCAGTCCTTG
AAACGGACTCTTCTCCTCCACCTGACAGTACTATTACTGTGGAAGTACCTACCACTTCAG
ATACAGAAGTTTACAGTGACTTTTATGCTGTGCCACCTCCCTGCAGTGTTGCTACCTCCT
TTCCTACAGACGATGAAGCTGAGAAGGCCAAAGCTGTTGCCGTGGCAACCGCAGCCGCAG
AGACAGCCCAGAGAATTCAGGAAGAAGAGTGCGGACCAAGAGATGACTTTAGTGATGCAG
ACCAGCTCAGAGTGGGTAATGATGCGATTTTCATGCTGGCGTTTTTCATGGCATTTATTT
TCAACTGGCTTGGATTTTGTTTATCCTTCTGTATCGCCAATACCATAGCTGGAAGTTATG
GTGTCATCTGTGGACTTGGACTTTCATTGATCAAATGGATTCTTATTGTTAGGTTTTCTG
ATTATTTTACTGGCTATTTCAATGGACAGTATTGGCTTTGGTGGATATTTCTTGTACTTG
GC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VLGLHLAVADAEVSAAAAGATGSEAARPGNRGGRNRGGRGAAATTSATGVDEG-VEHREDSPARKPDPEPGR-MDHHQPGTGRYQVLHNEEDNSESSAVE
VLGLHLA.ADAE.SAAAAGA.GSEAARPGNRGGRN.GGRGAAATTSATG..EG.VEHREDSPARKPDPEPG...DHHQPGTGRYQVLH.EEDNSESSA.E
Retrocopy
VLGLHLAAADAEASAAAAGAAGSEAARPGNRGGRNGGGRGAAATTSATGLGEG\VEHREDSPARKPDPEPGG\LDHHQPGTGRYQVLHDEEDNSESSAAE


Parental protein
QPSTSDAAPQSVQAAPSASVLETDSSPPPYSSITVEVPTTSDTEVYSEFYPVPPPYSVATSLPTYDEAEKAKAAAMAAAAAETAQRIQEEECQPRDDFSD
Q.STS.AAP.SVQ.APSASVLETDSSPPP.S.ITVEVPTTSDTEVYS.FY.VPPP.SVATS.PT.DEAEKAKA.A.A.AAAETAQRIQEEEC.PRDDFSD
Retrocopy
QRSTSNAAPPSVQTAPSASVLETDSSPPPDSTITVEVPTTSDTEVYSDFYAVPPPCSVATSFPTDDEAEKAKAVAVATAAAETAQRIQEEECGPRDDFSD


Parental protein
ADQLRVGNDGIFMLAFFMAFIFNWLGFCLSFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFLVLG
ADQLRVGND.IFMLAFFMAFIFNWLGFCLSFCI.NTIAG.YG.ICG.GLSLIKWILIVRFSDYFTGYFNGQYWLWWIFLVLG
Retrocopy
ADQLRVGNDAIFMLAFFMAFIFNWLGFCLSFCIANTIAGSYGVICGLGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFLVLG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide