RetrogeneDB ID:
retro_mputfur_1082
Organism:
Location:
GL897010.1:755209-755723 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
72.32 %
Coverage:
69.44 %
Frameshifts:
2
Stop codons:
3


Parental gene:
Parental gene symbol:
DERL1
Parental gene aliases:
No gene alias available
Parental gene description:
derlin 1 [Source:HGNC Symbol;Acc:28454]

Genomic region (view in browser)





>retro_mputfur_1082
TTCTTGTATCAGAATTTTACAGGACTTGAAACAGGAGCTTTTGATAGGTCAGCCACCAAT
TTACTCATGCTCCTCTTTAACTGGAATTGCATCGTGAAGACCAGCTTAGCCATGAACATG
CAGTTGCTGATGATTCCTCTGATCGTGTCAGTACTTTATGTCTGGGCCCAGCTGAACAGA
GACATGATTGTATCATTTTGGTTTGAAACACAAGTTAAGGCCTGTTATTTATCATGGTTA
TCCTTGGACTCAACTATATCATCGGAGGCTCGGTAATGAATGAGCTCATTGGAAATCTTG
TGGGACATCTTTAATTTCTCCTCATGTTCAGATACCCAATGACTTCGGATGAAGACATTT
TCTATCCACACCTGTTTTTGTACTGCTGGCTGTCCAGCAGGAGAGGAGGATGTCAGGATC
CAGTGTGTCCCCTGCTAGCATGAGGTGAGCTGCTGATCTGAATGGTAGAGGTAGAAGACA
CCACTGGGGACAGGACTTTCAGCTTGGGGACCAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FLYQYSTRLETGAFDGRPADYLFMLLFNWICIVITGLAMDMQLLMIPLIMSVLYVWAQLNRDMIVSFWFGTRFKACYLPW-VILGFNYIIGGSVINELIG
FLYQ..T.LETGAFD.R.A..L.MLLFNW.CIV.T.LAM.MQLLMIPLI.SVLYVWAQLNRDMIVSFWF.T..KACYL.W.VILG.NYIIGGSV.NELIG
Retrocopy
FLYQNFTGLETGAFD-RSATNLLMLLFNWNCIVKTSLAMNMQLLMIPLIVSVLYVWAQLNRDMIVSFWFETQVKACYLSW/VILGLNYIIGGSVMNELIG


Parental protein
NLVGHLYFFLMFRYPM-DLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGGRHNWGQGFRLGDQ
NLVGHL.F.LMFRYPM.D.G.R.FLSTP.F........R...SG..V.PASMR.AAD.N.G.G.RH.WGQ.F.LGDQ
Retrocopy
NLVGHL*FLLMFRYPM/DFG*RHFLSTPVFVLLAVQQER-RMSGSSVSPASMR*AADLN-GRGRRHHWGQDFQLGDQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide