RetrogeneDB ID:
retro_mputfur_1085
Organism:
Location:
GL897011.1:4337505-4337987 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
59.39 %
Coverage:
52.98 %
Frameshifts:
4
Stop codons:
0


Parental gene:
Parental gene symbol:
SRM
Parental gene aliases:
No gene alias available
Parental gene description:
spermidine synthase [Source:HGNC Symbol;Acc:11296]

Genomic region (view in browser)





>retro_mputfur_1085
CTCCTTGTCTTCTGCAGTGAGCACTGTGGCAACGTGCTAGTGTTGCACGGCGTCACCCAG
TGCATGGAGGGGGCTGATTCTCCCGGGATCTGATAGCCAACTTGCCCCTCTGTAGCCGCC
CCGTCCCCTGCCAGGTGCTGCTCATCGGGGCTGGAGATGGGGGTGACCTGCAGGAGGGGG
TGAAGCATTCCTCCGTGGAGTCAGCCTGTGGTCCAGTGGGAGACTGACAAGGATGCTGCT
CAGGTCTCTAGGAAGTTCCTGCCAGGCATAGCTGTGGGGGGCTGCGGCCCCAAGCTGACC
CTACATGTGGGCGATGGTTTTGAGTTCATGAAACAGAACAAGGATGCCTTTGATGTCATC
ATCACTGACTTCTGCAGACCCCCTGGTCTCTGCCAAGACTCTCTTCAAGGAGTTCTATCA
CCAGCTCGTGAAGGTGGCCCTCAAGGATGGTGGTGCGTGTCCCCTGCCAGGGCGAGTGGC
AG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ILVFRSKSYGNVLVLDGVIQCTERDE-FSYQEMIANLPLCSHPNPRKV-LIIGGGDGGVLREVLKHSSVES-VVQCEIDEDVIQVSKKFLPGMAVGYSSS
.LVF.S...GNVLVL.GV.QC.E....FS....IANLPLCS.P.P..V.LI..G..G.....V...S.....VVQ.E.D.D..QVS.KFLPG.AVG....
Retrocopy
LLVFCSEHCGNVLVLHGVTQCMEGAD/FS-RDLIANLPLCSRPVPCQVLLIGAGDGGDLQEGVKHSSVESA\VVQWETDKDAAQVSRKFLPGIAVGGCGP


Parental protein
KLTLHVGDGFEFMKQNQDAFDVIITD-SSDPMGPAESLFKESYYQLMKTALKDNGV-LCCQGECQ
KLTLHVGDGFEFMKQN.DAFDVIITD.S.DP...A..LFKE.Y.QL.K.ALKD.G....CQGE.Q
Retrocopy
KLTLHVGDGFEFMKQNKDAFDVIITD\SADPLVSAKTLFKEFYHQLVKVALKDGGA\VPCQGEWQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide