RetrogeneDB ID:
retro_mputfur_1087
Organism:
Location:
GL897011.1:6209915-6210442 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
60.77 %
Coverage:
50.86 %
Frameshifts:
3
Stop codons:
3


Parental gene:
Parental gene symbol:
MTHFD2
Parental gene aliases:
No gene alias available
Parental gene description:
methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase [Source:HGNC Symbol;Acc:7434]

Genomic region (view in browser)





>retro_mputfur_1087
AGTGTGGTTCTGGTTAGTGAGCAACCTGTAAGTCACTCCTCCAGCCTCAACAAAACCAGG
GCAGCTGCAGATATGGGAATCACTGCACCATGGTGAAACCAACTTCAGTTTCAGAGGAAG
AACTATTGAACTGAATCCATAAACTAAATAATGATAACATAGGTGGTGGCCTCCTTGGTT
CAGCTGCCTCTTCCAGATCACATGGATGAGGAAGAGATCTGTAATACTGTTTCTCCAGAC
AAGGATGTTGATGGCTTTCATGTCATTCATGTAAAGCAAATTTGTATGGACCAGTATTCC
ATGTTACTGATGACCTCATGGAGTGTCTAGGAAATAATTAAGCAAACTGGCATTCCAACC
CCAGAGAAGAATATGATTGTGGCAAGAAGATCAAAAATGTTGAAATGCCCATTGCAATAC
TACTACACACAGATGGGGCACATGAATGACATAAAGGCAATGAGATTATAATATCTCATC
CATATACTCTCAAACATACAGTTCTGGCAGATATTGTGGTCTCTAAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SVVLVGENPASHSYVLN-KTRAAAEVGINSETIVKPASVSEEELLNLINKLNNDDDVDGLL-VQLPLPEHIDERKICNAVSPDKDVDGFHVINVGRMCLD
SVVLV.E.P.SHS..LN.........G.N..T.VKP.SVSEEELLN.I.KLNND....GLL.VQLPLP.H.DE..ICN.VSPDKDVDGFHVI.V...C.D
Retrocopy
SVVLVSEQPVSHSSSLN/QNQGSCRYG-NHCTMVKPTSVSEEELLN*IHKLNNDNIGGGLL\VQLPLPDHMDEEEICNTVSPDKDVDGFHVIHVKQICMD


Parental protein
QYSMLPATPWGVWEIIKRTGIPTLGKNVVVAGRS-KNVGMPIAMLLHTDGAHERPGGDATVTISHRHTPKEQLKKHTVLAD
QYSML..T.W.V.EIIK.TGIPT..KN..VA.RS.KNV.MPIA.LLHTDGAHE...G.....ISH..T.K.......V...
Retrocopy
QYSMLLMTSWSV*EIIKQTGIPTPEKNMIVARRS/KNVEMPIAILLHTDGAHE*HKGN-EIIISHPYTLKHTVLADIVVSN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide