RetrogeneDB ID:
retro_mputfur_1089
Organism:
Location:
GL897012.1:598581-598974 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.19 %
Coverage:
57.02 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
PSMA6
Parental gene aliases:
No gene alias available
Parental gene description:
proteasome (prosome, macropain) subunit, alpha type, 6 [Source:HGNC Symbol;Acc:9535]

Genomic region (view in browser)





>retro_mputfur_1089
ATTGTCACACAGAAGATAATACCTGACAAATCATTGGATTCTAGTACAATGACTCCCTTA
TTCAAGATAACTGAAAATATTGGCTTAGTAATGATAGGAATGACCGCTGATGACAGATCC
TGGGTACCAAGGCATGCTATGAGGCAGGTAATTGGAAATAAAAGTATGGTTGGCTCTAAA
ATTTTCTGTGGATATGCTGCATAAAAGAATTGCTGATGTTTCTCAGGTCTACACACAGAA
TGCTAACATAAAGCCTCCTGATTTTTGTGTAGTTTTCATTGGTATAATGAGGTATACACT
CCTTAGGTGTACAGGTGTGATCCTCAGGGTTACTACCATGTGTTTAAAGTCACTGCAGCA
GGAATTAAACAAACCAAGTCAACCAGCTTCCTT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
IVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQR-ARYEAANW--KYKY-GYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGI-D
IVTQK..PDK.LDSST.T.LFKITENIG.VM.GMTAD.RS.V.R.A.YEA.NW..KY........VDML.KRIAD.SQVYTQNA...P...C...IGI..
Retrocopy
IVTQKIIPDKSLDSSTMTPLFKITENIGLVMIGMTADDRSWVPR/ACYEAGNWK*KYGW/ALKFSVDMLHKRIADVSQVYTQNANIKPPDFCVVFIGI/N


Parental protein
EEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFL
E...P.VY.CDP.GYY..FK.TAAG.KQT.STSFL
Retrocopy
EVYTP*VYRCDPQGYYHVFKVTAAGIKQTKSTSFL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide