RetrogeneDB ID:
retro_mputfur_1092
Organism:
Location:
GL897012.1:5848558-5848964 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
57.25 %
Coverage:
91.89 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
UBE2L6
Parental gene aliases:
No gene alias available
Parental gene description:
ubiquitin-conjugating enzyme E2L 6 [Source:HGNC Symbol;Acc:12490]

Genomic region (view in browser)





>retro_mputfur_1092
GATCTTCAGGCAAAACTTCTCTCCTATCTGTGGACCTCCTCAGCAACAGTGCCTACATCC
TCATATGACATTTACTCCTCCTGCCTGAGAAAATGCCCTCCAAACTCAAGAACTCCAATG
TACATATCAATATCCCAGAGGACTTTCTGTTCAAACCCCCTCAGTGACATTCACAAGCAG
GATCTACCACCCTCATGTGGGCAATAAGAGAGAGGTTTGCCTGTCCATCATCAGCAATGA
TAACTGGAAGCCTTACAGCAAGACCAGCCACGTCTTAGAGGCCCTCAGTGGAGTAGTGAA
TAAATCAGACCTGGGACAGTCCATTTGGGTGAAACTCACTGATCTGTTGACCTAAGAACC
AGAGCTGTTCAACAGTGAGGTTAGAGAGCTCACCTTTAAGTATGGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
DLQAELPPYLR-NLFIDDADVLVWHVLLLPEEPPYNLKAFHVRISFPKDYPFKPP-TVTFTTRIYHPNVGHDGSVCLPIISRENWQPHTKTSQVLEALSV
DLQA.L..YL...L....A..L..H.LLLPE..P..LK...V.I..P.D..FKPP..VTFT.RIYHP.VG....VCL.IIS..NW.P..KTS.VLEALS.
Retrocopy
DLQAKLLSYLW/DLLSNSAYILI*HLLLLPEKMPSKLKNSNVHINIPEDFLFKPP/SVTFTSRIYHPHVGNKREVCLSIISNDNWKPYSKTSHVLEALSG


Parental protein
LVNRPDLGQPIRLELADLLAENPERFNSEAREFTLKYG
.VN..DLGQ.I...L.DLL...PE.FNSE.RE.T.KYG
Retrocopy
VVNKSDLGQSIWVKLTDLLT*EPELFNSEVRELTFKYG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide