RetrogeneDB ID:
retro_mputfur_1093
Organism:
Location:
GL897012.1:6218690-6219005 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
63.3 %
Coverage:
63.69 %
Frameshifts:
2
Stop codons:
3


Parental gene:
Parental gene symbol:
NME1
Parental gene aliases:
No gene alias available
Parental gene description:
NME/NM23 nucleoside diphosphate kinase 1 [Source:HGNC Symbol;Acc:7849]

Genomic region (view in browser)





>retro_mputfur_1093
GATTGACTTTCAATGACCATCATTGACCTGAAGGACTATGTATTTTTTGCTGGCCTGGTA
AAACACATGCAATCAAGGCCTGTGGTTGCCATAGTCTAAGAGGGGCTGAATGTGGTGAAG
ACAGGCCAAGTGATGCTCAGGAACCCCAACCCTGCAGATTCTAAGCCTGAACCATCCATG
GGGACTTTTGCATCCAAGTTGGTGGGAACATAATCCATGCTAATGATTTTGTGGAGTGCA
GAGGAGATTGGCTTGTGGTTTGGCTTGAGGCGCTGGTAGATTACTTATAGTTGTGGTCAA
AACTAGATCTGTGAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
DLLKEHYIDLKDRPFFAGLVKYMQSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPG-TIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFQPEELVDY-K
D.L....IDLKD..FFAGLVK.MQS.PVVA.V.EGLNVVKTG.VML...NPADSKP..TI.GDFCIQVG.NIIH..D.VE........W...E.LVDY..
Retrocopy
D*LSMTIIDLKDYVFFAGLVKHMQSRPVVAIV*EGLNVVKTGQVMLRNPNPADSKPE/TIHGDFCIQVGGNIIHANDFVECRGDWLVVWL--EALVDY\Y


Parental protein
SCAQSWIYE
SC.Q..I.E
Retrocopy
SCGQN*ICE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide