RetrogeneDB ID:
retro_mputfur_1096
Organism:
Location:
GL897012.1:6430696-6431111 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
53.9 %
Coverage:
59.66 %
Frameshifts:
2
Stop codons:
3


Parental gene:
Parental gene symbol:
C8orf33
Parental gene aliases:
No gene alias available
Parental gene description:
chromosome 8 open reading frame 33 [Source:HGNC Symbol;Acc:26104]

Genomic region (view in browser)





>retro_mputfur_1096
AAGAAGCAAAAGAAGAAAACCCGGAACAAAGCTTCAGCGACCAATGCCATCGGAAGTCCT
CTGAAAAGCGGGGCTTTGGAGGATGCCCTTCTAAGCGCAGAGGCTCAGGTGGACCAGTTG
GCCCCAGAATTGGCGTGATGCATGGGGCAGCTGGAGTTGGGCCTCGAAATGCTGAGACCC
AGTCTGAAACAGAAAGTATAGGCTGTTGGGGCAATCCCCTCCTGCCCAATGAAAGCACCC
CTATGCCAGGAGGAGGTAGCTGATGTGCTCCTTGTTTGGGGACTGCAGGGATCAGACAGA
AGCCCACGGGGCGCAAAACCTATGGGTTCTCAGGGCTGCAGCCTGCATAGGACAGGAGCA
GCCTGTCACTCGGCCACTAGAAAAGAAGAGCCAAAGGGTCTGCAGGCCGATCCAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KQTKKKSRNGASVANGGGQVSEEPVSEEAPVSAEAQAEQLARELAWCVDQLELGLKMQRPSPRQKEQAAGAIRT-LRSERTPLP-RKRQLMRSLFGDYRA
K..KKK.RN.AS..N..G........E.A..SAEAQ..QLA.ELA.C..QLELGL.M.RPS..QK..A.GAI...L..E.TP.P.R.R.LM.SLFGD.R.
Retrocopy
KKQKKKTRNKASATNAIGSPLKSGALEDALLSAEAQVDQLAPELA*CMGQLELGLEMLRPSLKQKV*AVGAIPS/LPNESTPMP/RRR*LMCSLFGDCRD


Parental protein
QMEAERREALRVLRTAARAAQVQPVGEAARKKNGRVCRPRQ
Q.EA.....L.VLR.AA...Q.QPV.....KK..RVCRP.Q
Retrocopy
QTEAHGAQNLWVLRAAACIGQEQPVTRPLEKKSQRVCRPIQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide