RetrogeneDB ID:
retro_mputfur_1099
Organism:
Location:
GL897014.1:5832464-5832803 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
63.72 %
Coverage:
96.55 %
Frameshifts:
0
Stop codons:
3


Parental gene:
Parental gene symbol:
DNAJC19
Parental gene aliases:
No gene alias available
Parental gene description:
DnaJ (Hsp40) homolog, subfamily C, member 19 [Source:HGNC Symbol;Acc:30528]

Genomic region (view in browser)





>retro_mputfur_1099
GTGGTACACATTGGCCTGACCATTGCCTCTGCAGGATTTGCAGACCATTATGGCTGGCAA
GCCATGAAACATATGAAGCCTCAAGTAAAACAAGTTTTTCAAAATCTACTAAAATCTGCC
TCTAGTGGTGGCATTATAGAGATGTGTTTGAACCCAAAATGATAAAACAAGAAGCAACAT
AATATGAGGTGTAGATGCAAACCTACAGCCAATAAAGGAAAAATAGGAGATATTCACCAA
TGAACTATGCTTTTAAATCACCCAGACAAGGGAAGATCTCCTTATAGAGCAGCCCAAATC
CATGAAGCTAAAGATTTACAAGAAGGTCAAGCTAAAAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKM-TKREAALILGISPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKI
VV..GLTIA.AGFA..Y..QAMKHM.PQVKQVFQ.L.KSA.SGG.......PK...K..........PTANKGKI.D.H...MLLNHPDKG.SPY.AA.I
Retrocopy
VVHIGLTIASAGFADHYGWQAMKHMKPQVKQVFQNLLKSASSGGIIEMCLNPK**NKKQHNMRCRCKPTANKGKIGDIHQ*TMLLNHPDKGRSPYRAAQI


Parental protein
NEAKDLLEGQAKK
.EAKDL.EGQAKK
Retrocopy
HEAKDLQEGQAKK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide