RetrogeneDB ID:
retro_mputfur_1102
Organism:
Location:
GL897016.1:217802-218234 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
70.27 %
Coverage:
75.65 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_mputfur_1102
GCTGGGAGGACACCTAGGTGCAACTCTCCTCTGTTGTCTCGAATCTGGGTTCATCCGACA
CCTGCCGCCTCCGCCATGCCGCCTGAGTTCAACCTCAGGGACATCAAAGTCATATACCTG
AGGTGCACCGGTGGGGAAGTCACTGCCACTTCCGCCCCGGCCCTTAAGACTGGCCCCCCT
GGGTCTGTCTCCAAGAAAGTTTGGTGATGATATCGCCAAGGCAAGAGGTGATGGGAAGGG
TCTGAAGATTACAATGAAACTGACCATTCAGAACAGACAGACCCAGACTGAAGCGGTACC
TTCTGACTTGGTGCCGATTACCAAAGCCTTCAAGGAACCACCAAGAGATAGAAAGAAGCA
GAAAAACATTAAGCACCATGGAAAATCACTTATGATGAGATTGTCAATATTGCCCAACAG
ATGTGACACCAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ARRRQRCNSLRSSRIRVHPTPATSAMPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGP-LGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVV
A.R..RCNS...SRI.VHPTPA.SAMPP.F....IKV.YLRCTGGEV.ATSA.A.K.GP.LGLSP.K.GDDIAKA.GD.KGL.IT.KLTIQNRQ.Q.E.V
Retrocopy
AGRTPRCNSPLLSRIWVHPTPAASAMPPEFNLRDIKVIYLRCTGGEVTATSAPALKTGP\LGLSPRKFGDDIAKARGDGKGLKITMKLTIQNRQTQTEAV


Parental protein
PSASALIIKALKEPPRDRKKQKNSAVKHSG-NITFDEIVNIARQMRHR
PS....I.KA.KEPPRDRKKQKN...KH.G..IT.DEIVNIA.QM.H.
Retrocopy
PSDLVPITKAFKEPPRDRKKQKN--IKHHG/KITYDEIVNIAQQM*HQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide