RetrogeneDB ID:
retro_mputfur_1105
Organism:
Location:
GL897017.1:2354745-2356004 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.75 %
Coverage:
99.53 %
Frameshifts:
12
Stop codons:
0


Parental gene:
Parental gene symbol:
SF3B4
Parental gene aliases:
No gene alias available
Parental gene description:
splicing factor 3b, subunit 4, 49kDa [Source:HGNC Symbol;Acc:10771]

Genomic region (view in browser)





>retro_mputfur_1105
GCAGCCAGGCTGATCTCTGAGCAGAACCAGGGTGCTGCTATCTACGTGGGAGGCTTGGAT
GGGGAGGTTGGCCAACCACGGCTGTGGGAGCTAATCCTCCAGGCAGGGCCAGTAGTCACC
TCCCGCATGCCAAAGGATGAAGTCACAGATCAGCACCAGGCCAAGGCTTTGTGGAATTCT
TGGACAACGAGGAAGCTGACTACACCACGAAGATCATGAACCTGATCAAACTGTGTGGGA
AGGTGGACCAGACATCAGCTCGCAAGAACCTGGATGTGGGGCCAACGTTGTTGTTGGCAA
CCTGGACTCAGAGATGGATAGGAAGCTGTTTATGGTATTTCCAGTGCCTTTGGGGTGATT
TTACAAACTCCAGAGATTGTGTGGGACCCTAACACAGGCAACTCCAAAGATTATGCCTTT
ATTAATTTTGTTTTGTTTGATGCTTTGGAAGCAGCTGTTCATGTTCTGAATGGGCATTAT
CTCTGTAACCGCCCTATCACTGTGCCCTGTGCCTTTGAGAAGGACTCCAAGGGTCAGCAC
CAGGGTTCAGCAGCCGAACAACTTCTGGCAGCCCAGAACCAACCTACTCTCGCAGGCTGA
TTGCCCTTGTCAGCTCCTTGCAGAGTCACCCTCTCCACCTTCAACCCCCAATTCTGTGGC
ATCATCACTGGGATCTGGGCTTCCTCCCTCAGGTAGCCCTCCTCCTCGGCCCCTCCCACC
CCCAGTGCTGCCTCCTGGAACCATTCTACCTGGGATACCCCCAGCTAGGCCCCCATTACC
TGTGTCTCCTGAGGCTGGAGGACATGGCCCACCATCATCAGGAATGCAGGGTCTGGACAT
CCTGGACATGGACACTCACATCCTCACCAATTCTCACTGTATGGGATGCCCTATCCAGGG
ATCTCAGATACAGCTGGCCTACCATGGCCCTCATGGGTCAGGACATCCCCATTCCAGGCC
ATCAGGCTCTGGGGGGCAGCCATCACCCCAACCCTCACCTGGCATGCCTCATCTAGGACC
TCCTCTAATGGGCATGCCTCCCGTCCCCCACCAGTGGCCTCTGTTTGGATCTCCCACGCG
TCATCCAGGTCTATGCCTCTACATGGGATGCATGGACCTCCTCCACGGATGCCCCTCATG
GATACACTGGGCTTCCACCACCCCCCACCAGATGGCTACCGGTGGGGGCCCCCTCCCTCC
ACCCAGACCAACCCCCGGCCTCTAGTTCTCCTTGTGGCCCACTTTCAGACACTTTTCCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQ-GYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVG-
AA..ISE.NQ.A..YVGGLD..V..P.LWEL.LQAGPVV...MPKD.VT.QHQ.G.GFVEFL..E.ADY..KIMN.IKL.GK...V...SA..KNLDVG.
Retrocopy
AARLISEQNQGAAIYVGGLDGEVGQPRLWELILQAGPVVTSRMPKDEVTDQHQ/GQGFVEFLDNEEADYTTKIMNLIKLCGK---VDQTSAR-KNLDVG/


Parental protein
ANIFIGNLDPEIDEKL-LYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAER-LLAA
AN...GNLD.E.D.KL..Y...SAFGVILQTP.I..DP.TGNSK.YAFINF..FDA..AA....NG.YLCNRPITV..AF.KDSKG...GSAAE..L.A.
Retrocopy
ANVVVGNLDSEMDRKL/VYGISSAFGVILQTPEIVWDPNTGNSKDYAFINFVLFDALEAAVHVLNGHYLCNRPITVPCAFEKDSKGQHQGSAAEQLLAAQ


Parental protein
QNP-LSQADRPHQLFADAPPPPSAPNPVVSSLGSGLPPPGMPPPGSFPPPVPPPGALPPGIPPAMPPPPMPPGAGGHGPPSAG-TPGAGHPGHGHSHPHP
..P.LSQAD.P.QL.A..P.PPS.PN.V.SSLGSGLPP.G.PPP...PPPV.PPG...PGIPPA.PP.P..P.AGGHGPPS.G...G.GHPGHGHSHPH.
Retrocopy
NQP\LSQADCPCQLLAESPSPPSTPNSVASSLGSGLPPSGSPPPRPLPPPVLPPGTILPGIPPARPPLPVSPEAGGHGPPSSG/NAGSGHPGHGHSHPHQ


Parental protein
FPPGGM-PHPGMSQMQLAHHGPHGLGHPHAGPPGSGGQPPPRPPPGMPHPGPPPMGMPP---RGPPFGSPMGHPG-PMPPHGMRGPPPLMP-PHGYTGPP
F...GM.P..G.SQ.QLA.HGPHG.GHPH..P.GSGGQP.P.P.PGMPH.GPP.MGMPP.....P.FGSP..HPG..MP.HGM.GPPP.MP.PHGYTG.P
Retrocopy
FSLYGM\PIQG-SQIQLAYHGPHGSGHPHSRPSGSGGQPSPQPSPGMPHLGPPLMGMPPVPHQWPLFGSPTRHPG/SMPLHGMHGPPPRMP/PHGYTGLP


Parental protein
-RPPPYGYQ-RGPLPPPRPT-PRPPV-PPRGPLRGPLP
..PPP.GY...GPLPPPRPT.PRP.V..P.GPL....P
Retrocopy
\HPPPDGYR\GGPLPPPRPT/PRPLV/SPCGPLSDTFP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide