RetrogeneDB ID:
retro_mputfur_1106
Organism:
Location:
GL897018.1:2200874-2201411 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
63.64 %
Coverage:
78.35 %
Frameshifts:
5
Stop codons:
2


Parental gene:
Parental gene symbol:
NDUFV2
Parental gene aliases:
No gene alias available
Parental gene description:
NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa [Source:HGNC Symbol;Acc:7717]

Genomic region (view in browser)





>retro_mputfur_1106
AACTATCCAGATGGGCACAAAGCAGCAGCTGTGCTTCCAGATCTGGATTTAGTCCAAAGA
TAGAGTGGATGGGTGCCTACCTCTGCCACGGATAAGGTGGAAGTTCTCCAAGTACCTCTG
GTGAGAGTACATGAAGTAACAACTTTTTGTACCATGTATAATGGAAATCCAGTTAGAAAG
TATAAATTCAGTTCTCCTGCTATACCTTGAATGCTTCAAAGCTCTGACATCATCCAAATA
GAAAGCCATTCAGAAAAAGCTAGGAAAAAAGTTAGGGGTATTATACCTGATGAACTTTTC
ACTCTTACAGTGGTAGAGTGTTTAGGGACTATGTAACTGCACCCATGGCTCAAAGAAATA
GCAACTACCATGAAGATCTGACACCTCAGGGTATTGAAGAAAGTATTGATGAGCTCAAGG
CTACAGAATTCCAAAACTTGAGTCAGGGAGCAGATGGTTCTCTTTGAGCCAGCTGGAGGT
CTTACCTCTTTGACTGAACTACCCAAAGGACCTGGCTTTGGTGTGCAAGCAGGTCTT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
NYPEGHKAAAILPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSI-LEA-IQKKLGIKVG-ETTP
NYP.GHKAAA.LP.LDL.QR..GW.P.SA..KV.EVLQVP..RV.EV.TF.TMYN..PV.KY........P.ML..SD.I..E..IQKKLG.K.G....P
Retrocopy
NYPDGHKAAAVLPDLDLVQR*SGWVPTSATDKV-EVLQVPLVRVHEVTTFCTMYNGNPVRKYKFS-SPAIP*MLQSSDIIQIES\IQKKLGKKLG/GIIP


Parental protein
DKLFTLIEVECLGAC-VNAPMVQINDNYYEDLTPKDIEEIIDELKAG-KVPKPGPRSGRFSC-EPAGGLTSLTEPPKGPGFGVQAGL
D.LFTL..VECLG...V.APM.Q.N.NY.EDLTP..IEE.IDELKA....PK....S..FS..EPAGGLTSLTE.PKGPGFGVQAGL
Retrocopy
DELFTLTVVECLGTM/VTAPMAQRNSNYHEDLTPQGIEESIDELKAT/RIPKLESGSRWFSL/EPAGGLTSLTELPKGPGFGVQAGL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide