RetrogeneDB ID:
retro_mputfur_1107
Organism:
Location:
GL897018.1:5101572-5101930 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
74.17 %
Coverage:
72.84 %
Frameshifts:
1
Stop codons:
4


Parental gene:
Parental gene symbol:
Dhfr
Parental gene aliases:
No gene alias available
Parental gene description:
dihydrofolate reductase [Source:MGI Symbol;Acc:MGI:94890]

Genomic region (view in browser)





>retro_mputfur_1107
GAAGGTAAATAGAATTTCGTGATTATGGGTCGGAAGACAGACTCACTCTCTTCCCTAAAA
GAACTGACTTTTAAAGAACAGAGTTCAATTAGTTCTCAGAAGAGAACTCAAGGAACCTCT
ACAAGGTGCTCATTTTCTAGCCAAAAGTCTGGGTGATGCCTTAAAACTTATTTAACAACC
AGAATTAACAAAGAAAGTGGACATGGTTTGGATAGTGGGAGGCAGTTCTGCTTATAAGGA
AGGCATGAACAAATCAGACCATCTCAAACTATTTGTGACAAGGATCATGCAGGAATTTGA
AAATAACACATTTTTTTTTCCAGAAACTGATTTGGGGAAATATAAGCTTCTTCCAGAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EGKQNLVIMGRKT-WFSIPEKNRPLKDRINLVLSRDLKEPPQGAHFLAKSLDDALKLIEQPELANKVDMVWIVGGSSVYKEAMNKPGHLRLFVTRIMQEF
EGK.N.VIMGRKT...S.P.KN..LK.R..LVL.R.LKEP.QGAHFLAKSL.DALKLI.QPEL..KVDMVWIVGGSS.YKE.MNK..HL.LFVTRIMQEF
Retrocopy
EGK*NFVIMGRKT\THSLP*KN*LLKNRVQLVLRRELKEPLQGAHFLAKSLGDALKLI*QPELTKKVDMVWIVGGSSAYKEGMNKSDHLKLFVTRIMQEF


Parental protein
ESDT-FFPEIDLEKYKLLPE
E..T...PE.DL.KYKLLPE
Retrocopy
ENNTXXXPETDLGKYKLLPE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide