RetrogeneDB ID:
retro_mputfur_1108
Organism:
Location:
GL897019.1:844321-844689 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
65.87 %
Coverage:
90.44 %
Frameshifts:
3
Stop codons:
1


Parental gene:
Parental gene symbol:
RPL27
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L27 [Source:HGNC Symbol;Acc:10328]

Genomic region (view in browser)





>retro_mputfur_1108
TTAGGTGGTGTTGCTCCTGGCCAGACACTGCTCCAGACGCAAAGCATTGATGATGGCACC
TCAAACTGTCCCTACAGTCATACTTTGGTGGTTGGAAATGACCACCATCCCCACAAAGTG
ACAGCTGCCATGGGGAAGAAGAAAATCACCCAGAGATCAAAGATCAAGTCTTTTGTGAAA
GTTGGTAACTACAAACAACTTCATGCCCACAAGGTACTCTGTGGATACCCCCTTTGACAA
AACTGTCATCAACAGGACATCTTCAGAGGCCCTACTCTTAAACACAGGCCTGAAGAGAGG
CCAAGGTCAAGTTCGAGAAGAAGTATGAGACAAGCAAGAACAAGTGGTTCTTCCAGAAGC
TCCAGTTT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LAGRYSGRKAVIVKNIDDGTSDRPYSHALVAGIDRYPRKVTAAMGKKKIAKRSKIKSFVKVYNY-NHLMPTRYSVDIPLDKTVVNK-DVFRDPALKRK-A
L.G...G........IDDGTS..PYSH.LV.G.D..P.KVTAAMGKKKI..RSKIKSFVKV.NY.N..MPTRYSVD.P.DKTV.N..D.FR.P.LK...A
Retrocopy
LGGVAPGQTLLQTQSIDDGTSNCPYSHTLVVGNDHHPHKVTAAMGKKKITQRSKIKSFVKVGNY\NNFMPTRYSVDTPFDKTVINR/DIFRGPTLKHR/A


Parental protein
RREAKVKFEERYKTGKNKWFFQKLRF
.REAKVKFE..Y.T.KNKWFFQKL.F
Retrocopy
*REAKVKFEKKYETSKNKWFFQKLQF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide