RetrogeneDB ID:
retro_mputfur_1115
Organism:
Location:
GL897020.1:4503325-4503849 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
78.98 %
Coverage:
57.0 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
SEC22A
Parental gene aliases:
No gene alias available
Parental gene description:
SEC22 vesicle trafficking protein homolog A (S. cerevisiae) [Source:HGNC Symbol;Acc:20260]

Genomic region (view in browser)





>retro_mputfur_1115
CTGCAGGAGTGCAGAAAACATTTTAAAACACTTTCAAAGAAACTTGCTCAGCTTCCTAAT
GGATGTACCCTGAAAACTGGACATTATAATATTCATTTTATTAGCTCCCTGGGAATGAGT
TACATGATGTTGTGCCCTGAAAATTACCCAAATGCTCTGGTCTTCTCTATCCTGGATGAG
CTTCAGAAGGAGTTCACTACTACTTATAACATGATGAAGACAAACCCTGCTGTCAGACCA
TACTGTTTCATTGAGCTTGATAACTTCATTCAGAGGACCAAGCAGCAATATAATCATCCT
GGTTCTCTTTCAACAGAGATAAATCTATCAGACATGCAGATGGAAATCAAGCTGAGGCCC
CCTTATCAAATTCTGTGTGTGAACTGGCGTTGGCCCATGGAGTCACATCTGCATTTTCTT
TTGACTCTAAAGGTGCTGGTAAGGTTTCTTCTGCTCACCTGTGACTGGAACCAGTGGCTC
TGTCAGAGACTGTGGCATTTATCCTCAGTCTTATATGCAGCTCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VQECRKYFKMLSKKLAQLPDRCTLKTGHYNINFISSLGVSYMMLCTENYPNVLAFSFLDELQKEFITTYNMMKTNTAVRPYCFIEFDNFIQRTKQRYNNP
.QECRK.FK.LSKKLAQLP..CTLKTGHYNI.FISSLG.SYMMLC.ENYPN.L.FS.LDELQKEF.TTYNMMKTN.AVRPYCFIE.DNFIQRTKQ.YN.P
Retrocopy
LQECRKHFKTLSKKLAQLPNGCTLKTGHYNIHFISSLGMSYMMLCPENYPNALVFSILDELQKEFTTTYNMMKTNPAVRPYCFIELDNFIQRTKQQYNHP


Parental protein
RSLSTKINLSDMQMEIKLRPPYQI-SMCELGSANGVTSAFAIDYKGGGKISSAHQRLEPATLSGIVAFILSLLCGA
.SLST.INLSDMQMEIKLRPPYQI.S.CEL..A.GVTSAF..D.KG.GK.SSAH..LEP..LS..VAFILSL.C..
Retrocopy
GSLSTEINLSDMQMEIKLRPPYQI/SVCELALAHGVTSAFSFDSKGAGKVSSAHL*LEPVALSETVAFILSLICSS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide