RetrogeneDB ID:
retro_mputfur_1118
Organism:
Location:
GL897020.1:31381-32594 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.41 %
Coverage:
72.17 %
Frameshifts:
8
Stop codons:
5


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
Heat shock 60kDa protein 1 [Source:UniProtKB/TrEMBL;Acc:G9K4Y8]

Genomic region (view in browser)





>retro_mputfur_1118
CTTTGCCAGATAAGGTCAGTGTCCAAGGCACTAGTTCTTCATCTCACTGGGGCATATACT
AAGGATATAAAATTTGGTGCAGATTTCCAACTTCTGATGCTTCAGAGTGTATATACCTTT
TATTCCATGCTATGCCATACTATGGGCCAAAGGAAAAGCAACCAATATTGCACAGAGCTG
TGGAAGTCCTAAAGTAACAAAAGATGGTGTGACTTTGCAAAATCCATTGACTTAAAGGAT
AAATATAAAAACATTGTTGCTAAACTTGTTCAAGATGTTGCCAATAACATAAATGAAGAA
GCTGAGGATGGTACCCCTACTGCTATTGTTCTGACACACTCTATTGCCAAAGGTGGCTTT
GGGAGGATTAGCAAAAATGCTAATCCAGTGGAAATCAGAAGAGGTGTGATGTTATCTCTT
GATGTTGTAATTGCTGAACTTAAGAAGCAGTCTAAACTTGCGACAACCCGTACAGAAACT
GCTCAGGTTTCAGTGATTTCTGCAAGTGGAGACAAAAGAATCGGCAAGGTCATTTCTGAT
GCAATGAAGAAGGCTAGAACAAAGGGTGTTAATAGAGCAAAGGATGGACAAATACTACAC
GAGGAATTAGAAATTCTTGAAGGCATGAAGTTTGATTGAGGTTCTATTTCTCCATACTTT
AATAAATCAGGTCAGAAATGTGAATTCCAAGATGCCTATTTTCTATTGAATGAAAAGAAA
ATTTCTAGCATCCAGCATATTGTGTCTGTTTCTGAAATTGCCCATGCTTGCCATAAGCCC
TTGGTCATAACTGATGGAGATGGTCTAAGTACATTAATTTTGAATACACTAAAATCTGGT
CTTCAGGTTATAGTGGTCAAAGCTCTTGGTTTTGGTGAGAATAGAACCAGATTAAAGACA
TGGCTATTGCTATTGCTACTGGTAGTACCATGTTTGGAGAGAGATAGACTCTAAATCTTG
AAAATGTTCAACCTCATGACTGAGGAAAAGTTGGAGAATTCATTGTACCAAGGATGATGC
CATGTTCTTAAAAGGAAATGTGGGAAGGCTCAAATTGAAAACTATATTCAATAAATCATC
AAGCACTTAGATATCACAGCTATTAAAAATGAAAAGGAAAAATAAATGATCATCTGGCAA
AAATCTGAGATGCAGTAGGTATGCCCAGTTTGGTGGGATAAATGGTGTTGAAATGAATGA
AAAGAAATTTAGG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LRQIRPVSRALAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTM-GPK-GRTVIIEQSWGSPKVTKDGVTV-AKSIDLKDKYKNIGAKLVQDVANN
L.QIR.VS.AL..HLT.AY.KD.KFGAD...LMLQ.V.........TM.GPK.G....I.QS.GSPKVTKDGVT..AKSIDLKDKYKNI.AKLVQDVANN
Retrocopy
LCQIRSVSKALVLHLTGAYTKDIKFGADFQLLMLQSVYTFYSMLCHTM/GPK/GKATNIAQSCGSPKVTKDGVTL/AKSIDLKDKYKNIVAKLVQDVANN


Parental protein
TNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRESGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKEIGNIISDAMKKVGRKGVITVK
.NEEA.DGT.TA.VL..SIAK.GF..ISK.ANPVEIRR..GVML..D.VIAELKKQSK..TT..E.AQV..ISA.GDK.IG..ISDAMKK...KGV...K
Retrocopy
INEEAEDGTPTAIVLTHSIAKGGFGRISKNANPVEIRR--GVMLSLDVVIAELKKQSKLATTRTETAQVSVISASGDKRIGKVISDAMKKARTKGVNRAK


Parental protein
DGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSVQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKA
DG..L..ELEI.EGMKFD.G.ISPYF.....GQKCEFQDAY.LL.EKKISS.Q.IV...EIA.A..KPLVI.....DG..LSTL.LN.LK.GLQV..VKA
Retrocopy
DGQILHEELEILEGMKFD*GSISPYF--NKSGQKCEFQDAYFLLNEKKISSIQHIVSVSEIAHACHKPLVI----TDGDGLSTLILNTLKSGLQVIVVKA


Parental protein
PGFGDNRKNQLK-DMA--IATGGAVFGEEGLTLNLEDVQPHDLGKVGEVIV-TKDDAMLLKG-KGDKAQIEKRIQEIIEQLDITTSEYEKE-KLNERLAK
.GFG.NR...LK.DMA..IATG...FGE...TLNLE.VQPHD.GKVGE.IV.TKDDAM.LKG.K..KAQIE..IQ.II..LDIT....EKE.K.N..LAK
Retrocopy
LGFGENR-TRLK/DMAIAIATGSTMFGER-*TLNLENVQPHD*GKVGEFIV/TKDDAMFLKG/KCGKAQIENYIQ*IIKHLDITAIKNEKE/KINDHLAK


Parental protein
LSDGVAV-LKVGGTSDVEVNEKKDR
..D.V......GG...VE.NEKK.R
Retrocopy
I*DAVGM/AQFGGINGVEMNEKKFR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide