RetrogeneDB ID:
retro_mputfur_1119
Organism:
Location:
GL897020.1:1267841-1268149 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
73.33 %
Coverage:
81.25 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
Gm11808
Parental gene aliases:
No gene alias available
Parental gene description:
predicted gene 11808 [Source:MGI Symbol;Acc:MGI:3649356]

Genomic region (view in browser)





>retro_mputfur_1119
GATGTCAAAGTCAAAATCCAAGACGAGAAAGGCATCCCACCTGACCTGCAGCATCTGATT
TGTGCGGGTATCAGCTGGAAGATGGCCACACTCTGTCAGACTACAATATCCAGAAAGAGT
CTACCCTGCACTTGGTGTCTCGGCTCTGGGGAGGCATCGTTGAGCCTTCCCTCCATGCAC
TGGCCCAGAAACACAACCATGACAAGTTTATCTTCTGCCAGTGTTGTGCTCGCCTGCACC
CCCACGCTGTCATCTGCCCCAAGAAGTACGGCCATACCAACAATCTGCGCCCCCAAAAGA
AGGTTAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
NVKAKIQDKEGIPPDQQRLIFAG-KQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNNLRP
.VK.KIQD..GIPPD.Q.LI.AG..QLEDG.TLSDYNIQKESTLHLV.RL.GGI.EPSL..LAQK.N.DK.I...C.ARLHP.AV.C..KK.GHTNNLRP
Retrocopy
DVKVKIQDEKGIPPDLQHLICAG/YQLEDGHTLSDYNIQKESTLHLVSRLWGGIVEPSLHALAQKHNHDKFIFCQCCARLHPHAVIC-PKKYGHTNNLRP


Parental protein
KKKVK
.KKVK
Retrocopy
QKKVK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide