RetrogeneDB ID:
retro_mputfur_1121
Organism:
Location:
GL897020.1:4433696-4434637 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
85.76 %
Coverage:
96.63 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
CSNK2A2
Parental gene aliases:
No gene alias available
Parental gene description:
casein kinase 2, alpha prime polypeptide [Source:HGNC Symbol;Acc:2459]

Genomic region (view in browser)





>retro_mputfur_1121
GATCAAGATGATTACCAACTGGTTGGAAACTTGGTCGAGGAAAGTATAGTGAACTATTTG
AGGCCATCAGCACCACCAACAATGAGAGAGAGGTTGTAAATATTCTCAAGCCAATGAAGA
AAAAGAAGATAAAACGAGAGGTTAAGATTCTGGAGAACCTCCGTGGTGGAACAAATATCA
TTAAGCTGATCGACACTGTGAAGGACCCTGTGTCAAAGACCCCAGCTTTGGTATTTGAAT
GTATCAGTACTACAGATCTTAAGCAACTTGACCAGGTCCTGACAGACTTTGATATCGGGT
TTTATATGTATGAGCTACTTAAGGCCCTGGATTCCTGCCACGGCAAGGGAATCACGCACA
GGAATGTGAAACCTCACAAGGTCGTGAGAGATCACCAGCCGAAAAAGCTGCGACTGATAG
CCTGGGGTCTGGCAGAGTTCCACCATCCTGCTCAGGAGTACAATGTCCGTGTAGCCTCGA
GATATTTCAAGGGCCCGGAGCTTCTTGTGGACGATCAGATGTATGATTACAGCTTGGACA
TGTGGAGTTTGGGCTATGTGTTAGCAATGATCTTTCGAAAGGAGCCCTTCTGTCACGGAC
AGCACAACTATGACCAGCTTGTTCGCATTGCCAAGGTTCTGGGTACAGATGAGCTGTATG
GGTATCTGAAGAAATATCACATAGACCTAGATCCGCACTTCAACGAAATCCTGGGACAAC
ATTCACGGAAATGCTGGGAAAACTTTATCCATAGTGAGAACAGATACCTCGTCAGCCCCG
AGGCTCTAGATCTTCTGGACAAATTTCTGCGATACGACCATCAACAGACACTGACTGCCA
AAGAGGCCATGGAGCACCCGGACTTCTATACCCTGCTGAAGGAGCAGCCCCAGCCTTCTG
CAGGCAACACTGTGCTTTCCAGGGGCCTCACGGCAGCCCGG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
NQDDYQLVR-KLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDI
.QDDYQLV..KLGRGKYSE.FEAI..TNNER.VV.ILKP.KKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFE.I..TD.KQL.Q.LTDFDI
Retrocopy
DQDDYQLVG/KLGRGKYSELFEAISTTNNEREVVNILKPMKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFECISTTDLKQLDQVLTDFDI


Parental protein
RFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFF
.FYMYELLKALD.CH.KGI.HR.VKPH.V..DHQ.KKLRLI.WGLAEF.HPAQEYNVRVASRYFKGPELLVD.QMYDYSLDMWSLG..LA.MIFRKEPF.
Retrocopy
GFYMYELLKALDSCHGKGITHRNVKPHKVVRDHQPKKLRLIAWGLAEFHHPAQEYNVRVASRYFKGPELLVDDQMYDYSLDMWSLGYVLA-MIFRKEPFC


Parental protein
HGQDNYDQLVRIAKVLGTDELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQ
HGQ.NYDQLVRIAKVLGTDELYGYLKKYHIDLDPHFN.ILGQHSRK.WENFIHSENR.LVSPEALDLLDK.LRYDHQQ.LTAKEAMEHP.FY...KEQ.Q
Retrocopy
HGQHNYDQLVRIAKVLGTDELYGYLKKYHIDLDPHFNEILGQHSRKCWENFIHSENRYLVSPEALDLLDKFLRYDHQQTLTAKEAMEHPDFYTLLKEQPQ


Parental protein
PSADNAVLSSGLTAAR
PSA.N.VLS.GLTAAR
Retrocopy
PSAGNTVLSRGLTAAR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide