RetrogeneDB ID:
retro_mputfur_1122
Organism:
Location:
GL897020.1:5447908-5448287 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
72.09 %
Coverage:
54.74 %
Frameshifts:
2
Stop codons:
3


Parental gene:
Parental gene symbol:
CACYBP
Parental gene aliases:
No gene alias available
Parental gene description:
calcyclin binding protein [Source:HGNC Symbol;Acc:30423]

Genomic region (view in browser)





>retro_mputfur_1122
CTCCAGAAAGACCCAGGGGAGGTGAAGGTGCTGCTGGAATAGGCCACTAGAAAAAGAGTA
CACAATGCCCTTACCTTTGAAAGTCCAAGATGGAGACAGAAATCTAGACCAAGATGCCAC
TGAAATCGCAGAGAGCAGCAGAACCTCTTGACAATGAAAAGCCAGCTGCCATGGTTGCTC
CCTTGACAATGGGATGTACAGTGAAAATCAGTGATTGCGGATGGGATCGGCAGATAAATT
TGTGAAGATCTACCTCACCTTAAGTTGAGTTTGTCAAGTCCCCACTGAGAACACACATGT
GCATTTCACAGAGACCTCATTTGATCTTTTGGTAAAGAATATGAATGGGAAGAGTCACTC
CATGGTCATGAACAATCTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LQKDLEEVKVLLEKTSRKRVRDALTAE-KSKIETEIKNKMQQKSQRKAELLDNEKPAAVVAPITTGYTVKISNYGWDQ-SDKFVKIYITLTGVHQVPTEN
LQKD..EVKVLLE...RKRV..ALT.E.KSK.ETEI..KM..KSQR.AE.LDNEKPAA.VAP.T.G.TVKIS..GWD...DKFVKIY.TL..V.QVPTEN
Retrocopy
LQKDPGEVKVLLE*ATRKRVHNALTFE/KSKMETEI*TKMPLKSQRAAEPLDNEKPAAMVAPLTMGCTVKISDCGWDR/ADKFVKIYLTLS*VCQVPTEN


Parental protein
VQVHFTERSFDLLVKNLNGKSYSMIVNNL
..VHFTE.SFDLLVKN.NGKS.SM..NNL
Retrocopy
THVHFTETSFDLLVKNMNGKSHSMVMNNL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide