RetrogeneDB ID:
retro_mputfur_1125
Organism:
Location:
GL897022.1:704490-704841 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
73.73 %
Coverage:
57.28 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
BTF3
Parental gene aliases:
No gene alias available
Parental gene description:
basic transcription factor 3 [Source:HGNC Symbol;Acc:1125]

Genomic region (view in browser)





>retro_mputfur_1125
CAGCTACAACTTAAAAAGTTCGGGGTAAACAGTATCTCTGATATAAAAGTGAGTATGTTC
ACAAACCAAGGAACACTGATCTGCTTTAACAACTCCAAAGTTCAGGAATCGCTAGCAGCA
AACACTTTCACCATTAAAGGCCACGCTGAGACAAAGCAGCTGACAGAAATCCTACCCAGG
GTCTTAAACAAACTCAGTGCAGAGATTCTGACCAGTTCAAGAAGACTGGCTGAAGCTCAG
CCCAAATAATCTGTGGATGGAAAAGCCCCACTTGCTACTGAAGAGGAGGAGGATGATGCA
GTTCCAGATCTTACAGAGAACTCAGAAGAAGCTTCCAAGAATAAAGCAAAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQSVDGKAPLATGEDDDD
Q..LKK.GVN.IS.I..V.MFTNQGT.I.FNN.KVQ.SLAANTFTI.GHAETKQLTE.LP..LN.L.A..LTS.RRLAEA.PK.SVDGKAPLAT.E..DD
Retrocopy
QLQLKKFGVNSISDIK-VSMFTNQGTLICFNNSKVQESLAANTFTIKGHAETKQLTEILPRVLNKLSAEILTSSRRLAEAQPK*SVDGKAPLATEEEEDD


Parental protein
EVPDLVENFDEASKNEAN
.VPDL.EN..EASKN.AN
Retrocopy
AVPDLTENSEEASKNKAN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide