RetrogeneDB ID:
retro_mputfur_1129
Organism:
Location:
GL897022.1:3378307-3378638 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
71.17 %
Coverage:
74.32 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
SSBP1
Parental gene aliases:
No gene alias available
Parental gene description:
single-stranded DNA binding protein 1, mitochondrial [Source:HGNC Symbol;Acc:11317]

Genomic region (view in browser)





>retro_mputfur_1129
CAGAGACCTGTATTAGAGGCATTTCATCAGTTTGTAAGATGTGAGTCTGAAATAGTGAGC
AACTTGGTTCTTGAGAGATCTCTGAACCATGTGCAGCTACTTGGGTGAGTGGGTCAGGAC
TCCCGTCATGAGACGGGTGGGAGGGGAAAACCCAATCACAGTATCTTTTCTAGCAATGAA
TGAGATGTGGTGGTCAGGGGAGAATGAAGCATACCAAAAGGGTGATATCAGTAAGAAGAC
AACATGGCACAGAATATCAGTATTCCAACCAGGCATCGGAGATATGGTCTATCAGGATGT
GGAAAAGGGGTCCCGAATTTATGTGAAAGGG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RRPVLQVFHQFVRRESEVATSLVLERSLNRVQLLGRVGQD-PVMRQVEGKNPVTIFSLATNEMWRSGESEAYQMGDVSQKTTWHRISVFRPGLRDVAYQY
.RPVL..FHQFVR.ESE....LVLERSLN.VQLLG.VGQD.PVMR.V.G.NP.T...LA.NEMW.SGE.EAYQ.GD.S.KTTWHRISVF.PG..D..YQ.
Retrocopy
QRPVLEAFHQFVRCESEIVSNLVLERSLNHVQLLG*VGQD\PVMRRVGGENPITVSFLAMNEMWWSGENEAYQKGDISKKTTWHRISVFQPGIGDMVYQD


Parental protein
VKKGSRIYVEG
V.KGSRIYV.G
Retrocopy
VEKGSRIYVKG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide