RetrogeneDB ID:
retro_mputfur_1130
Organism:
Location:
GL897022.1:6102510-6102823 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
68.57 %
Coverage:
85.25 %
Frameshifts:
1
Stop codons:
3


Parental gene:
Parental gene symbol:
Gm2178
Parental gene aliases:
No gene alias available
Parental gene description:
predicted gene 2178 [Source:MGI Symbol;Acc:MGI:3780348]

Genomic region (view in browser)





>retro_mputfur_1130
CATCATATGCTGTCCTACAGTACAACCTCTAATAAAACTAGGCTGTCCTGAATTGTTTAC
CTTTATATCAAGAAGGCTGGGAATGCACCAAAATCTGCATGTGGAGTGTGCCTAGGCTAA
CTTCCAGGAGTTCGTGCTGTGAGATCTCAAGTGCTTATGAGGTTGTCTAAAATGATAAAA
ACAAGTCAGCAAGGCCTATGGTGGTTCCATGTGTGCTAAGTGTGTTCGTGACAGGATCAA
GCATGCTTTCCTTATCGAGGAGCAGAAAATCATCGTGAAAACATTATAGGCAAAAGCACA
GAGCCAGAATGCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
YNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKTKK-HVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKAQA
....S..T....T....IVYLY.KK.G.APKSACGVC.G.L.GVRAVR..VLMRLSK..K..VS.AYGGSMCAKCVRDRIK.AFLIEEQKI.VK.L.A.A
Retrocopy
HHMLSYSTTSNKTRLS*IVYLYIKKAGNAPKSACGVCLG*LPGVRAVRSQVLMRLSKMIK\QVSKAYGGSMCAKCVRDRIKHAFLIEEQKIIVKTL*AKA


Parental protein
QSQKA
QSQ.A
Retrocopy
QSQNA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide