RetrogeneDB ID:
retro_mputfur_1134
Organism:
Location:
GL897023.1:3117595-3118098 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
58.43 %
Coverage:
82.86 %
Frameshifts:
4
Stop codons:
5


Parental gene:
Parental gene symbol:
HMGB2
Parental gene aliases:
No gene alias available
Parental gene description:
high mobility group box 2 [Source:HGNC Symbol;Acc:5000]

Genomic region (view in browser)





>retro_mputfur_1134
ATGGGCAGAGAAAATCTGAAGAAGCCAAGAGGTAAAATGTCCTCATGTGCATCCTTTGTG
CAAACTTGCTGAGAACACAAAGAAGCACCCAGAGGCTTCAGTCAACTTCTCAGAATTTTC
TAAGAAGTGCTCAGAAAGGTGGAAGACCATGTCTGCTAAGAAAAATGAAAATTGGAAGAC
ATGGCAAGGTGGACAAGAAAAGAAAGAGGAAAAGAAAACTTATATCCCCGCTAAGGGGGA
AACAAACAGATGTTCAGGGATCCCAGTGCACTGGAGGCCTCCTCTGGCCTCTTCCTTGTT
TTGTGCTGAGCTTCACCCAAAAATCAGAGAACATCCTGGCCTATCCGTTGGTGACATTGC
AAAGAAATTGGGAGAGTGAAGTAACACTGCTGTATATGGCAAACAGCCTTATGAAAAGAA
GGCTGCCAAGCTAAAGAAAAAAATATGTATAGGATATTGTTGCATATCCAGCTAAAGGAA
AGTCTGATGTGGCAAAAAAGGGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHP-DSSVNFAEFSKKCSERWKTMSAK-EKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRP
MG.....KPRGKMSS.A.FVQTC.E...K..P...SVNF.EFSKKCSERWKTMSAK.EK.K.EDMA.....R..R...N..P..G..K....DP.A....
Retrocopy
MGRENLKKPRGKMSSCASFVQTC*EH--KEAP\EASVNFSEFSKKCSERWKTMSAK/EK*KLEDMAR--WTRKERGKENLYPR*GGNKQMFRDPSA-LEA


Parental protein
PSAFFL-FCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLK-EKYEKDIAAYRAKGKSEAGKKG
.S..FL.FC.E..PKI..EHPGLS.GD.AKKLGE..S......KQPYE.KAAKLK..KY..DI.AY.AKGKS...KKG
Retrocopy
SSGLFL\FCAELHPKIR-EHPGLSVGDIAKKLGE-*SNTAVYGKQPYEKKAAKLK\KKYV*DIVAYPAKGKSDVAKKG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide