RetrogeneDB ID:
retro_mputfur_1136
Organism:
Location:
GL897023.1:4021997-4022359 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
65.32 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
3


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_mputfur_1136
AGGGCCAAGATGAAACCTTGAGACCTTCGTGGCAAGAAGGAGGAGCTGCTTAAACTGCTG
GAAGAGCTGAGGTGAAGCCATCCCAGCTGCACATTGCCAGAGGGACCTGTGGCATGGCTT
CCAAGCTCTCCAAGGTCCAAGTTGTTGGCGGATCCATTGCCAGTGTTCTCACAGTCATCA
ACCAGAAAGAGAACTAAGGCAGGAAATTCTACAAAGGTAAGAAGTGCAAGCCCCTGGGTC
TGCGGCCCAAGAAGACATGCGTCACGTGCCGCTGGCTGAACTAGCACGAGGAAGAGCTGA
AGACCGAGAAGCAGCTGCAGAAGGAGCAGCTCTACCCACTGAGGAAGTACATGGTCGAAG
CT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QAKIKARDLRGKKKEELLKQLEDLK-VELSQLRVAKVTGGAASKLSKIRVVRKSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHE
.AK.K..DLRGKK.EELLK.LE.L..V..SQL..A..T.G.ASKLSK..VV..SIA.VLTVINQ......RKFYKGKK.KPL.LRPKKT....R.LN.HE
Retrocopy
RAKMKP*DLRGKK-EELLKLLEELR/VKPSQLHIARGTCGMASKLSKVQVVGGSIASVLTVINQKEN*G-RKFYKGKKCKPLGLRPKKTCVTCRWLN*HE


Parental protein
ENLKTKKQQRKERLYPLRKYAVKA
E.LKT.KQ..KE.LYPLRKY.V.A
Retrocopy
EELKTEKQLQKEQLYPLRKYMVEA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide