RetrogeneDB ID:
retro_mputfur_1144
Organism:
Location:
GL897024.1:5247676-5249611 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
89.08 %
Coverage:
100.0 %
Frameshifts:
3
Stop codons:
1


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
Heat shock cognate 71 kDa protein [Source:UniProtKB/TrEMBL;Acc:G9K4X7]

Genomic region (view in browser)





>retro_mputfur_1144
ATGTCTAAGGGACCTGCAGTTGGCATTGATCTTGGCACCACCTACTCCTGCGTGGGTGTC
TTCCAGCAAGGGAAAGTGGAAATAATTGCTAATGATCAGGGAAACCGGACCACCCCAAGT
TATGTCGTCTTCACAGACACCGAACAATTGATCAGTGATGCTGCAAAGAACCAAGTTGTG
ATGAACCCCACCAGCACAGTTTTTTTTTATGCCAAAGGCCTAATTGGATGGAGATTTGAT
GATGCTGTTGTCCAGTCTGATATGAAGCTTTGGACTTTCATGGTGGTGAATGATGCTGGA
AGGCCCAAGGTCCAAGTAGAATACAAGGCAGAGACAAAAGCTTTGATCCAGAGGAGGTGT
CTTCTATGGTTTTAACAAAAATGAAGGAAATCGCAGAAGCTTATCTTGGGAAGACCGTTA
CCAATGCAGTTGTCACAGTACTTGCATACTTCAATGATTCTCAGCATCAGGCTACCAAAG
ATGCTGGAACTATTGCTGGTCTCAATGTACTTTGAATCATCAATGAGCCAACTGCTGCTG
CTATTACTTATAGCTTAGACAAAAATGTTGGAGCTGAAAGGAATGTGTTGATCTTTGACT
TAAGAGGTCACACTTTTGATGTGTCAATCCTTACTATTGAAGATGGGATCTTTGAGGTTA
AGTCCACAGCTGGAAACACCCACTTAGGTGGAGAAGACTTTAACAACCGAATGGTCAACC
ATTTTATTGCAGAGTTCAAGTGCAAGCATAAGAAAGATATCAGTGAAAACAAGAGGGCAG
TTCATCGCCTCCGTACTGCTTGTGAATGTGCTAAGTGTACACTTTCTTCCAGCACCCAGG
CCAGTATTGAGATTGATTCTCTGTATGAAGGAATTGACTTCTATACCTCTATCACTCATG
CCTGGTTTGAAGAATTAAATGCTGACCTGTTCCGTGGCACCCTGGACCCTGTAGAGAAAG
CCCTTTCGGATGCCAAGTTAGACAAGTCTCAGATCCATGATATTGTCCTGGTGGGTGGTT
CTACCCGTATGGCCAAGATTCAGAAACTTCTTCAAGATTTCTTCAATGGAAAAGAACTGA
ATAAGAGCATAAACCCTGATGAGGCTGTTGCTTATGTTGCAGCTGTCCAGGCAGCCATCC
TTTCTGGAGACAAATCTGAAAATGTTCAAGATTTGCTACTGTTGGATGTCACTCCACTTT
CTCTTGGCATTGAAACTGCTGGAGGAGTCATGACTGTTCTCATCAAGCATAATACTATCA
TTCCTACCAGACACAGACCTTCACTACCTACTCTGACAACCAGCCTGGTGTGCTTATTCA
GGTGTATGAAGGTGAGCATGCCATGACCAAGGAAAACAATCTACTTGGAAAGTTTGAACT
CACAAGCATACCTCCTGCTCCTCGTGGTGTCCCTCAGATTGAGGTCACTTTCGATATTGA
TGCTAATGTTATCCTCAATGTCTCTGCCGTGGATAAGAGCACAGAAAAGAGAACAAGATT
ACCATCACTAATGACAAGGGCCACTTGAGCAAGGAAGATATTGATCGCATGGTCCAGGAA
GCTGAGAAGTACAAAGCTGAAGATGAGAAACAGCGGGACAAGGTGTATTCCAAGAATTCA
CTGGAGTCTTATGCATTCAACATGAAAGCAACTGTTGAAGACGAAAAACTTCAGGGCAAG
ATAAATGATGAAAACAAACAGAAGATTCTTGACAAGTGCAATGAAATCATCAACTGGCTT
GATAAGAACCAGACTGCAGAGAAGGAAGAATTTGAACACCAGCAGAAAGAGTTGGAGAAA
GTCTCCAACCCCATCATCACCAAGCTGTACCAGAGTGCAGGGGGCATGCCAGGAGGAATG
CCTGGAGGCTTCCCTGGTGGTGGAGCTCCTCCCTCTGGTGGTGCCTCCTCTGGGCCCATC
ATTGAAGAGGTTGAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFD-AKRLIGRRFDDAVVQSDMKHWPFMVVNDAG
MSKGPAVGIDLGTTYSCVGVFQ.GKVEIIANDQGNRTTPSYV.FTDTE.LI.DAAKNQV.MNPT.T....AK.LIG.RFDDAVVQSDMK.W.FMVVNDAG
Retrocopy
MSKGPAVGIDLGTTYSCVGVFQQGKVEIIANDQGNRTTPSYVVFTDTEQLISDAAKNQVVMNPTSTXXXXAKGLIGWRFDDAVVQSDMKLWTFMVVNDAG


Parental protein
RPKVQVEYKGETK-SFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIF
RPKVQVEYK.ETK.SF.PEEVSSMVLTKMKEIAEAYLGKTVTNAVVTV.AYFNDSQ.QATKDAGTIAGLNVL.IINEPTAAAI.Y.LDK.VGAERNVLIF
Retrocopy
RPKVQVEYKAETK/SFDPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVLAYFNDSQHQATKDAGTIAGLNVL*IINEPTAAAITYSLDKNVGAERNVLIF


Parental protein
DLGGGTFDVSILTIEDGIFEVKSTAGDSHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKCTLSSSTQASIEIDSLYEGIDFYTSIT
DL.G.TFDVSILTIEDGIFEVKSTAG..HLGGEDF.NRMVNHFIAEFK.KHKKDISENKRAV.RLRTACE.AKCTLSSSTQASIEIDSLYEGIDFYTSIT
Retrocopy
DLRGHTFDVSILTIEDGIFEVKSTAGNTHLGGEDFNNRMVNHFIAEFKCKHKKDISENKRAVHRLRTACECAKCTLSSSTQASIEIDSLYEGIDFYTSIT


Parental protein
RARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTP
.A.FEELNADLFRGTLDPVEKAL.DAKLDKSQIHDIVLVGGSTR..KIQKLLQDFFNGKELNKSINPDEAVAY.AAVQAAILSGDKSENVQDLLLLDVTP
Retrocopy
HAWFEELNADLFRGTLDPVEKALSDAKLDKSQIHDIVLVGGSTRMAKIQKLLQDFFNGKELNKSINPDEAVAYVAAVQAAILSGDKSENVQDLLLLDVTP


Parental protein
LSLGIETAGGVMTVLIKRNTTI-PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGK
LSLGIETAGGVMTVLI....TI....QTQTFTTYSDNQPGVLIQVYEGE.AMTK.NNLLGKFELT.IPPAPRGVPQIEVTFDIDAN.ILNVSAVDKST.K
Retrocopy
LSLGIETAGGVMTVLI-KHNTI/HSYQTQTFTTYSDNQPGVLIQVYEGEHAMTKENNLLGKFELTSIPPAPRGVPQIEVTFDIDANVILNVSAVDKSTEK


Parental protein
-ENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQ
.ENKITITNDKG.LSKEDI.RMVQEAEKYKAEDEKQRDKV.SKNSLESYAFNMKATVEDEKLQGKINDE.KQKILDKCNEIINWLDKNQTAEKEEFEHQQ
Retrocopy
/ENKITITNDKGHLSKEDIDRMVQEAEKYKAEDEKQRDKVYSKNSLESYAFNMKATVEDEKLQGKINDENKQKILDKCNEIINWLDKNQTAEKEEFEHQQ


Parental protein
KELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
KELEKV.NPIITKLYQSAGGMPGGMPGG..............GP.IEEVD
Retrocopy
KELEKVSNPIITKLYQSAGGMPGGMPGGXXXXXXXXXXXXXXGPIIEEVD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide