RetrogeneDB ID:
retro_mputfur_1147
Organism:
Location:
GL897026.1:4901671-4902037 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
73.77 %
Coverage:
61.62 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
SRI
Parental gene aliases:
No gene alias available
Parental gene description:
sorcin [Source:HGNC Symbol;Acc:11292]

Genomic region (view in browser)





>retro_mputfur_1147
CACAAACCTTTTAACATAGAGACTTGTCAGCTTATGAATTCAATGCTGGCTAGAAACAGG
TCAGGCACAATGGGTTGCAGTGAATGTTAAGAACTCTGGGCTGTTCTGAATGCCTGGACA
CAACAGTTCATCAGTTTTGACAGTGACTGGAGTGGAAGAGTAGATCCTCAGGAACTGCAG
AAGGCCCTGACCACAGTGGGATTTCAATCGAGTTCCCAAGCCATGACTTCAACAGCAAAC
TGATACAGCACCAATTTCAAGATCACCTTCAATGACTACATCACCTGCTGCGTCAAACTG
CGAGCTCTAACAGACGGCTTTCCAAGATGGGATACTGCTCCACAAGGTGTTGTGAATTTC
CCCTAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
YKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDSDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKL
.KPFN.ETC.LM.SML.R..SGTMG..E..ELWAVLN.W.Q.FISFDSD.SG.VDPQELQKALTT.GF..S.QA..S.A..YSTN.KITF.DYI.CCVKL
Retrocopy
HKPFNIETCQLMNSMLARNRSGTMGCSEC*ELWAVLNAWTQQFISFDSDWSGRVDPQELQKALTTVGFQSSSQAMTSTAN*YSTNFKITFNDYITCCVKL


Parental protein
RALTDSFRRRDTAQQGVVNFPY
RALTD.F.R.DTA.QGVVNFPY
Retrocopy
RALTDGFPRWDTAPQGVVNFPY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide